SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12)                    31   0.78 
SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7)                    28   7.3  

>SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12)
          Length = 1650

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 2/76 (2%)
 Frame = +2

Query: 434 YMGRESVFCGHPYQTECRRKYYTCFKRESIDYNVVIEDLQKRINEENPPLDNDEIELQDR 613
           Y  R S+   HPY TEC+ +Y      E     V  +DL ++ ++  P  ++ E  L + 
Sbjct: 323 YDDRMSIKVRHPYPTECQSRYVIHMLTE----GVFADDLSQQPSQAGPQSESPE-SLANS 377

Query: 614 RG--HRMTWKQYHRLE 655
           +G  H MT  ++  L+
Sbjct: 378 QGNSHEMTEFEHTELQ 393


>SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7)
          Length = 1376

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +2

Query: 515  ESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMTWK 637
            E+++ +V++E + + I +E P L+   IEL   R  R +WK
Sbjct: 954  ENVEESVLVEKVNEEIVDELP-LEETSIELVSLRVMRRSWK 993


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,414,402
Number of Sequences: 59808
Number of extensions: 436562
Number of successful extensions: 1274
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1274
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2095976575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -