SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_2181| Best HMM Match : RGS (HMM E-Value=0.11)                       30   1.9  
SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10)          29   3.4  
SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23)                    29   3.4  
SB_31088| Best HMM Match : CAP_GLY (HMM E-Value=2.2e-37)               28   5.9  
SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_18860| Best HMM Match : TIG (HMM E-Value=1.9)                       28   5.9  
SB_10686| Best HMM Match : NOA36 (HMM E-Value=0.57)                    28   5.9  
SB_50003| Best HMM Match : PAN (HMM E-Value=0.044)                     28   7.7  
SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14)                 28   7.7  
SB_11461| Best HMM Match : NHL (HMM E-Value=0)                         28   7.7  
SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   7.7  
SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0)                      28   7.7  
SB_8303| Best HMM Match : START (HMM E-Value=0.0093)                   28   7.7  
SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.7  

>SB_2181| Best HMM Match : RGS (HMM E-Value=0.11)
          Length = 1313

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 19/86 (22%), Positives = 39/86 (45%)
 Frame = +3

Query: 105 NSETFVCNYQLPSHSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVN 284
           + +++    +LP HS   + ++ +      ER    ++PE    +  +    K+G    N
Sbjct: 210 SDDSYANQRELPDHSASRISFDDNFEISYVEREKGTEEPESHTGAENKEDIDKDGSPDGN 269

Query: 285 RLMSESTIDVNHQNGHMNGDADEKIS 362
               + T D N  +G+ +GD D+ +S
Sbjct: 270 ---DDDTDDTNCSDGNNSGDEDDVVS 292


>SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10)
          Length = 1292

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/53 (32%), Positives = 23/53 (43%)
 Frame = +1

Query: 4   HEPQRT*ALSPRPSSATHAPQN*NRARCRCRDVETVKHLCAIISFLPIRISDC 162
           H+ Q+T  L  R  S TH  Q  N +RC    + TV+    I     +  S C
Sbjct: 533 HDAQKTQLLPGRKDSTTHVAQKLNFSRCAKAQLLTVRKGSTIHGVQRLNYSRC 585



 Score = 28.7 bits (61), Expect = 4.4
 Identities = 17/53 (32%), Positives = 23/53 (43%)
 Frame = +1

Query: 4   HEPQRT*ALSPRPSSATHAPQN*NRARCRCRDVETVKHLCAIISFLPIRISDC 162
           H+ Q+T  L  R  S TH  Q  N +RC    + TV+    I     +  S C
Sbjct: 102 HDAQKTQLLPVRKDSTTHVAQKLNFSRCAKAQLLTVRKGSTIHGAQRLNYSRC 154



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +1

Query: 4   HEPQRT*ALSPRPSSATHAPQN*NRARCRCRDVETVK 114
           H+ Q+T  L  R  S TH  Q  N  RC    + TV+
Sbjct: 60  HDAQKTQLLPVRKGSITHGAQRLNHPRCAKAQLLTVR 96



 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +1

Query: 4   HEPQRT*ALSPRPSSATHAPQN*NRARCRCRDVETVK 114
           H+ Q+T  L  R  S TH  Q  N  RC    + TV+
Sbjct: 491 HDAQKTQLLPVRKGSITHGAQRLNHPRCAKAQLLTVR 527


>SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23)
          Length = 877

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 198 RRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSES 302
           R  A++DP R H+ H   + F   H R++ L+ E+
Sbjct: 307 RNCALQDPHRGHQCHFVNEAFSRVHPRLSNLLLET 341


>SB_31088| Best HMM Match : CAP_GLY (HMM E-Value=2.2e-37)
          Length = 947

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +3

Query: 240 HREGKEFK-EGHFRVNRLMSESTIDVNHQNGHMNGDADEKISRTLNRAVSTSHL 398
           HRE +    E + +V +++ E  ++   +NG +  D   K+ R L++  STS L
Sbjct: 705 HRERQSSDLEDYDKVQKVLKEEIVNPLRRNGFVRADRVLKLRRLLDKLGSTSGL 758


>SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1744

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 126 NYQLPSHSDIGLRYEFHHGRL-TFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSES 302
           +Y L    + G   E    +  + E++ +V   E+D  +HR+G++ K+G  R + + S+ 
Sbjct: 598 SYSLTQLLEAGKAMEISRSQAASIEKQESVNKIEKDRPNHRQGRK-KDGRRRRDNVRSQQ 656

Query: 303 TID 311
           + D
Sbjct: 657 SRD 659


>SB_18860| Best HMM Match : TIG (HMM E-Value=1.9)
          Length = 245

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 600 GVEGKIRGGAMAVFGVEAAFEGG 532
           GVE  IRGG + + GVE    GG
Sbjct: 114 GVEFTIRGGGLTIGGVELTIRGG 136


>SB_10686| Best HMM Match : NOA36 (HMM E-Value=0.57)
          Length = 581

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 2/72 (2%)
 Frame = +3

Query: 174 HHGR-LTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDA- 347
           H GR LT   ++     E +      G+ F  GH + + L SE+   V H   H+ G A 
Sbjct: 273 HLGRHLTGHAKNDALSSENNKTVRHLGRHFT-GHAKNDALSSENNKTVRHLGRHLTGHAK 331

Query: 348 DEKISRTLNRAV 383
           ++ +S   N+ V
Sbjct: 332 NDALSSENNKTV 343


>SB_50003| Best HMM Match : PAN (HMM E-Value=0.044)
          Length = 286

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/57 (26%), Positives = 26/57 (45%)
 Frame = +1

Query: 457 TRVDSLRRPVQKE*CKDYSQQRKAAPAFKCGLNTEYGHRPSPYFPLDSSIGTSSFPP 627
           T +   RR + K+  ++  Q ++  PA +   N E    P P  PLD+    ++  P
Sbjct: 33  TNIRRQRREILKQELREKRQVQQLPPAPQPTANPEKAEEPQPLKPLDNYTSAAAAVP 89


>SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14)
          Length = 1242

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 126 NYQLPSHSDIGLRYEFHHGRL-TFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSES 302
           +Y L    + G   E    +  + E++ +V   E+D  +HR+G++ K+G  R + + S+ 
Sbjct: 128 SYSLTQLLEAGKAMELSRSQAASIEKQESVNKFEKDRPNHRQGRK-KDGRRRRDNVRSQQ 186

Query: 303 TID 311
           + D
Sbjct: 187 SRD 189


>SB_11461| Best HMM Match : NHL (HMM E-Value=0)
          Length = 819

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 17/53 (32%), Positives = 24/53 (45%)
 Frame = -1

Query: 272 VTFFKFLSLSVTSMISLWILDSGSSFKSESPMVKLVTQSDIRMGRKLIIAHKC 114
           V + KFL     +  +L  LDSG           LV+Q  +   RKL++  KC
Sbjct: 23  VRYMKFLLQGHINRETLQYLDSGEELTEALRARGLVSQKRLAFLRKLLVEAKC 75


>SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 946

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +3

Query: 126 NYQLPSHSDIGLRYEFHHGRL-TFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSES 302
           +Y L    + G   E    +  + E++ +V   E+D  +HR+G++ K+G  R + + S+ 
Sbjct: 605 SYSLTQLLEAGKAMELSRSQAASIEKQESVNKFEKDRPNHRQGRK-KDGRRRRDNVRSQQ 663

Query: 303 TID 311
           + D
Sbjct: 664 SRD 666


>SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0)
          Length = 1250

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +1

Query: 88   RCRDVETVKH-LCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLK 264
            R   +ET KH        LP + SD + +FT     +  D    +  E  E TE   +LK
Sbjct: 1153 RLEKIETPKHEKHKTAHSLPSKHSDDIPTFTARKVDIPLDSPEPVPNEPDEATE---HLK 1209

Query: 265  KVTSESTGLCPNLRST 312
            K   +S+G   +LRS+
Sbjct: 1210 KPVDKSSGSANSLRSS 1225


>SB_8303| Best HMM Match : START (HMM E-Value=0.0093)
          Length = 522

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = +2

Query: 383 LHFTFVRAHRPLDSCSACCPHRKWLHASIHSADRYKRNNAKIIASKGKLPPPSNAASTPN 562
           +H    +  RPL+S     PH    +   H  D  +  ++ +   K ++P  S+  S+P+
Sbjct: 446 IHQIDAKGKRPLNSRIRDIPHTLRKYHCEHKDDEIEEEDSSLSLEKRRMPSSSSEMSSPD 505


>SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 503

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 19/85 (22%), Positives = 36/85 (42%)
 Frame = +3

Query: 126 NYQLPSHSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSEST 305
           N ++   SD GLR E  HG   F  +   ++ +    +  E +  +E ++  NR      
Sbjct: 47  NSKVEQQSDTGLRDESDHGTRNFNEKGGPRETDA-RETVLEQEHCEERNYEENRKGGSGL 105

Query: 306 IDVNHQNGHMNGDADEKISRTLNRA 380
           ++   +  H+    D +  R  N+A
Sbjct: 106 LETESKQRHVE-PRDLEQERIRNQA 129


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,079,296
Number of Sequences: 59808
Number of extensions: 415024
Number of successful extensions: 1440
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1203
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1437
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -