SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_46666| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8)                     33   0.18 
SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072)                   33   0.18 
SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8)                     33   0.18 
SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0)                       33   0.18 
SB_40765| Best HMM Match : DX (HMM E-Value=1.4)                        33   0.18 
SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0)                       33   0.18 
SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.23 
SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6)             32   0.41 
SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.41 
SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1)                     29   2.9  
SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33)                    29   2.9  
SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076)         29   3.8  
SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.8  

>SB_46666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 229

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 18/27 (66%), Positives = 23/27 (85%)
 Frame = -1

Query: 254 GASANVVCAGVAEQHGYKFTFMNFFKI 174
           GASANVVCAG++EQ+GY  TF  FF++
Sbjct: 31  GASANVVCAGLSEQYGYPLTFNKFFRM 57


>SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8)
          Length = 174

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 110 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDL 165

Query: 688 WRYLGS 705
             YL +
Sbjct: 166 EIYLNN 171


>SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072)
          Length = 375

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 311 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDL 366

Query: 688 WRYLGS 705
             YL +
Sbjct: 367 EIYLNN 372


>SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8)
          Length = 361

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 297 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDL 352

Query: 688 WRYLGS 705
             YL +
Sbjct: 353 EIYLNN 358


>SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 581

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 517 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDL 572

Query: 688 WRYLGS 705
             YL +
Sbjct: 573 EIYLNN 578


>SB_40765| Best HMM Match : DX (HMM E-Value=1.4)
          Length = 278

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 214 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELDSIEHFKRDL 269

Query: 688 WRYLGS 705
             YL +
Sbjct: 270 EIYLNN 275


>SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 666

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           H D+  TR   NF+     A++     FY   PRTIR WN LP     E   +  FKR L
Sbjct: 602 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDL 657

Query: 688 WRYLGS 705
             YL +
Sbjct: 658 EIYLNN 663


>SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 824

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = +1

Query: 589 FYHILPRTIRLWNELPFTVFSERYDMSFFKRGLWRYLGS 705
           FY   PRTIR WN LP     E   +  FKR L  YL +
Sbjct: 784 FYSFFPRTIRHWNTLP-NELVELGSIEHFKRDLEIYLNN 821


>SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6)
          Length = 231

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +1

Query: 592 YHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           Y  LPR +RLWN LP +V   R     F  GL
Sbjct: 200 YSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231


>SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 232

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +1

Query: 592 YHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
           Y  LPR +RLWN LP +V   R     F  GL
Sbjct: 201 YSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232


>SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1)
          Length = 2075

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +1

Query: 592  YHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
            Y   PRTIR WN LP  V +   D+  FK  L
Sbjct: 1646 YSFFPRTIRTWNLLPAEVVNAA-DLPSFKSAL 1676


>SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33)
          Length = 609

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +1

Query: 508 HLDIFSTRLFSNFENGHVMASREYCGGFYHILPRTIRLWNELP 636
           H D+  TR   NF+     A++     FY   PRTIR WN LP
Sbjct: 543 HQDL-RTRNSHNFKYYQEKATKNKY--FYSFFPRTIRHWNTLP 582


>SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3142

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/32 (46%), Positives = 17/32 (53%)
 Frame = +1

Query: 592  YHILPRTIRLWNELPFTVFSERYDMSFFKRGL 687
            Y   PRTIR WN LP  V +   D+  FK  L
Sbjct: 1092 YSFFPRTIRTWNLLPAEVVNAA-DLPSFKSAL 1122


>SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076)
          Length = 888

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 12/23 (52%), Positives = 13/23 (56%)
 Frame = +1

Query: 592 YHILPRTIRLWNELPFTVFSERY 660
           Y  +PR IRLWN L  TV    Y
Sbjct: 746 YSFVPRAIRLWNSLEVTVVLAAY 768


>SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +1

Query: 592 YHILPRTIRLWNELPFTVFSE 654
           Y   PR IR+WN LP  V ++
Sbjct: 141 YSFFPRAIRIWNLLPSNVINQ 161


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,968,384
Number of Sequences: 59808
Number of extensions: 528833
Number of successful extensions: 1176
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1079
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1176
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1925890720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -