SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   5e-08
SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   5e-08
SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012)               47   2e-05
SB_44028| Best HMM Match : RVT_1 (HMM E-Value=1.3)                     35   0.073
SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30)        33   0.30 
SB_7503| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.39 
SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.90 
SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40)         31   0.90 
SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10)         31   0.90 
SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0)                31   0.90 
SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.)                31   0.90 
SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16)                      29   2.8  
SB_29682| Best HMM Match : PKD_channel (HMM E-Value=0.0011)            28   6.4  
SB_57416| Best HMM Match : rve (HMM E-Value=0.0011)                    28   8.4  
SB_45590| Best HMM Match : Syntaxin (HMM E-Value=0.61)                 28   8.4  
SB_39157| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  

>SB_27133| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 304

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 28/58 (48%), Positives = 36/58 (62%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E+ AS  Y++M  +F  D V  PGF K F +A+ EEREHA KL  + L RG
Sbjct: 150 VNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRG 207


>SB_27134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 289

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 28/58 (48%), Positives = 35/58 (60%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E+ AS  Y++M  +F  D V  PGF K F  A+ EEREHA KL  + L RG
Sbjct: 135 VNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRG 192


>SB_7534| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 28/58 (48%), Positives = 35/58 (60%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           + KQI  E+ AS  Y++M  +F  D V  PGF K F  A+ EEREHA KL  + L RG
Sbjct: 18  VNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRG 75


>SB_21296| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 358

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 29/64 (45%), Positives = 37/64 (57%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYL 455
           + C   + KQI  E+ AS  YL+M  +F  D V  PGF K F  A+ EEREHA KL+ + 
Sbjct: 197 EECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQ 256

Query: 456 LMRG 467
             RG
Sbjct: 257 NERG 260



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 351 AYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           A+F  D ++ PGFA  F  AA EE  HA   +++L  RG
Sbjct: 2   AHFGRDDIHLPGFAAFFKKAAEEEYTHAHMFMEFLNKRG 40


>SB_29575| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 394

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 25/55 (45%), Positives = 31/55 (56%)
 Frame = +3

Query: 276 QTCYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATK 440
           + C   + KQI  E+ AS  Y +M  YF  + V+ PGF K F   A EEREHA K
Sbjct: 10  EECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEK 64



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 22/62 (35%), Positives = 32/62 (51%)
 Frame = +2

Query: 488 RPHHVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLD 667
           R H  + P    W SG  A++ AL LE  V  ++ E+ KT E +  D  + D++   FL 
Sbjct: 59  REHAEKKPERDEWGSGLEAMQTALDLEKHVNQALIELEKTAEKN-GDAQMSDFIEDHFLT 117

Query: 668 EQ 673
           EQ
Sbjct: 118 EQ 119


>SB_58496| Best HMM Match : Ferritin (HMM E-Value=0.0012)
          Length = 126

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 3/81 (3%)
 Frame = +3

Query: 294 MRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKL 473
           + KQI +E+ A   YL+M  +F  D +N PGF K F  A+ EE EHA +++    ++ K 
Sbjct: 38  INKQINKELYAHYTYLSMAFHFDRDDINLPGFNKFFKKASKEEWEHA-QMVKTAALQTKC 96

Query: 474 TGSVTD---LITYRAPQTRRG 527
              +T    L  + A  T+RG
Sbjct: 97  YRKLTIVWLLFQFMAYLTKRG 117


>SB_44028| Best HMM Match : RVT_1 (HMM E-Value=1.3)
          Length = 249

 Score = 34.7 bits (76), Expect = 0.073
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
           +F++  +N+PG  ++ FDAA+E +   T L  YLL     T S+T ++
Sbjct: 30  HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKYLLHGPDCTNSLTGVL 75


>SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30)
          Length = 3071

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = +2

Query: 527  ESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLS 652
            ES A+ LEH L+ E++  N +R+   T  SS N+Y  V+YL+
Sbjct: 1823 ESKAADLEHRLETEANDKNKLRQENITLASSLNEYK-VNYLT 1863


>SB_7503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTD---LITYRAPQTRR 524
           +F  D +N PGF K F  A+ EE EHA +++    ++ K    +T    L  + A  T+R
Sbjct: 32  HFDRDDINLPGFNKFFKKASKEEWEHA-QMVKTAALQTKCYRKLTIVWLLFQFMAYLTKR 90

Query: 525 G 527
           G
Sbjct: 91  G 91


>SB_56909| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1379

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
           +F++  +N+PG  ++ FDAA+E +   T L   LL     T S+T ++
Sbjct: 350 HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKNLLHGPDCTNSLTGVL 395


>SB_30861| Best HMM Match : Peptidase_A17 (HMM E-Value=2.1e-40)
          Length = 1740

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 354  YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
            +F++  +N+PG  ++ FDAA+E +   T L   LL     T S+T ++
Sbjct: 868  HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKNLLHGPDCTNSLTGVL 913


>SB_25615| Best HMM Match : Peptidase_A17 (HMM E-Value=4.5e-10)
          Length = 475

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
           +F++  +N+PG  ++ FDAA+E +   T L   LL     T S+T ++
Sbjct: 151 HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKNLLHGPDCTNSLTGVL 196


>SB_5393| Best HMM Match : Peptidase_A17 (HMM E-Value=0)
          Length = 1244

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
           +F++  +N+PG  ++ FDAA+E +   T L   LL     T S+T ++
Sbjct: 667 HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKNLLHGPDCTNSLTGVL 712


>SB_616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1515

 Score = 31.1 bits (67), Expect = 0.90
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 354  YFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRGKLTGSVTDLI 497
            +F++  +N+PG  ++ FDAA+E +   T L   LL     T S+T ++
Sbjct: 945  HFAVTNINKPGKLRIIFDAASEYQ--GTSLNKNLLHGPDCTNSLTGVL 990


>SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16)
          Length = 2352

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +3

Query: 414  TEEREHATKLIDYLLMRGKLTGSVTDLITYRAPQTRRG 527
            ++ RE A + I   L+   LTGS T++I  R P   RG
Sbjct: 1841 SDHREQAAQEIQAFLLDMILTGSKTEIIELRGPDKPRG 1878


>SB_29682| Best HMM Match : PKD_channel (HMM E-Value=0.0011)
          Length = 318

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = +2

Query: 575 VTNSIREVIKTCESSFNDYHLVDYLSGEFLDE 670
           +  ++ EV    E   NDY ++DY+  +F ++
Sbjct: 187 INEALEEVSSDAEKQANDYEIIDYMMHKFKEQ 218


>SB_57416| Best HMM Match : rve (HMM E-Value=0.0011)
          Length = 807

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = +3

Query: 354 YFSIDTVNRPGFAKLFFDAATEEREHA 434
           +F + + N+PG  ++ FDAA + R ++
Sbjct: 138 HFGVTSANKPGCVRIVFDAAAKTRTNS 164


>SB_45590| Best HMM Match : Syntaxin (HMM E-Value=0.61)
          Length = 315

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = +2

Query: 494 HHVQGPANTSWESGASALEHALKLESDVTNSIREVIKTCES 616
           HH+  P  ++  SG S     L LES  T ++RE   TC++
Sbjct: 198 HHIDQPIVSNLLSGTSGRSTPLGLESACTRAVRE---TCDA 235


>SB_39157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 312

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = +2

Query: 587 IREVIKTCESSFNDYHLVDYLSGEFLDEQYKGNATRR 697
           +R V  T E  ++D H  DY S       YKGN   R
Sbjct: 6   VRVVSDTVELLWSDGHATDYKSSWLAQHAYKGNKKLR 42


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,414,467
Number of Sequences: 59808
Number of extensions: 410213
Number of successful extensions: 1023
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1023
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1841633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -