SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      159   2e-39
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       153   1e-37
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             153   2e-37
SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      124   5e-29
SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   2e-21
SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)                 81   1e-15
SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   4e-12
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 68   7e-12
SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)                 62   4e-10
SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.23 
SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.93 
SB_24074| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.93 
SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5)                   31   1.2  
SB_8849| Best HMM Match : F-box (HMM E-Value=0.86)                     30   1.6  
SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.2  
SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015)               30   2.2  
SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6)              29   2.8  
SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6)                    29   2.8  
SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5)                    29   2.8  
SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85)            29   2.8  
SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14)               29   3.8  
SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7)                    29   3.8  
SB_57167| Best HMM Match : Ribosomal_MRP8 (HMM E-Value=3)              29   5.0  
SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3)               28   6.6  
SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6)                      28   6.6  
SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11)                   28   6.6  
SB_41979| Best HMM Match : rve (HMM E-Value=1.3e-23)                   28   8.7  
SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3)                 28   8.7  
SB_8228| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.7  

>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  159 bits (387), Expect = 2e-39
 Identities = 71/84 (84%), Positives = 80/84 (95%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLI+DLGGGTFDVS+LTIEDGIFEVKSTAGDTHLGGEDFDN+MV+HFV++FK+KY
Sbjct: 190 GVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKY 249

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRA+RRLRTACERAKRT
Sbjct: 250 KKDITPNKRAMRRLRTACERAKRT 273



 Score =  141 bits (341), Expect = 6e-34
 Identities = 69/90 (76%), Positives = 78/90 (86%), Gaps = 2/90 (2%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM--DK 417
           K  LSSSTQASIEIDSLFEGIDFYTSITRARFEELN DLF+ T EPVE+++RD+K+   K
Sbjct: 271 KRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGK 330

Query: 418 AQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
             IHDIVLVGGSTRIPK+QK+LQ+ F GKE
Sbjct: 331 ESIHDIVLVGGSTRIPKIQKMLQELFGGKE 360



 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 41/72 (56%), Positives = 45/72 (62%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           ILHGDK + V+D           GIETAGGVM+ LIKR
Sbjct: 359 KELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKR 418

Query: 681 NTTIPTKQTQTF 716
           N+TIPTKQTQTF
Sbjct: 419 NSTIPTKQTQTF 430


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  153 bits (372), Expect = 1e-37
 Identities = 71/82 (86%), Positives = 78/82 (95%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDG-IFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKK 187
           +NVLIFDLGGGTFDVSILTI+DG +FEVKSTAGDTHLGGEDFDNR+VNHFV EFKRKYKK
Sbjct: 193 KNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKK 252

Query: 188 DLATNKRALRRLRTACERAKRT 253
           D++ N RA+RRLRTACERAKRT
Sbjct: 253 DMSKNSRAMRRLRTACERAKRT 274



 Score =  131 bits (316), Expect = 6e-31
 Identities = 58/87 (66%), Positives = 76/87 (87%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K  LSSST+ASIE+DSLFEGIDFYT I+RARFE+L +DLF S ++PV K+L DAK  K+ 
Sbjct: 272 KRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSD 331

Query: 424 IHDIVLVGGSTRIPKVQKLLQDFFNGK 504
           IH++VLVGGSTR+PK+QK+L+++F+GK
Sbjct: 332 IHEVVLVGGSTRVPKIQKMLEEYFSGK 358



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 39/72 (54%), Positives = 42/72 (58%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           IL GDKS+EV+D           GIETAG VMT LI+R
Sbjct: 358 KSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIER 417

Query: 681 NTTIPTKQTQTF 716
           N  IPTK TQTF
Sbjct: 418 NARIPTKATQTF 429


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  153 bits (370), Expect = 2e-37
 Identities = 70/84 (83%), Positives = 77/84 (91%)
 Frame = +2

Query: 2   GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKY 181
           G  RNVLIFDLGGGTFDVS+L+IEDGIFEVKST GDTHLGGEDFDN MV+ FV++FK+KY
Sbjct: 283 GQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKY 342

Query: 182 KKDLATNKRALRRLRTACERAKRT 253
           KKD+  NKRALRRLRTACERAKRT
Sbjct: 343 KKDITPNKRALRRLRTACERAKRT 366



 Score =  138 bits (335), Expect = 3e-33
 Identities = 65/89 (73%), Positives = 81/89 (91%), Gaps = 1/89 (1%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD-KA 420
           K  LSSSTQASIEIDSL++GIDFYTSITRARFEE+NA LF+ T+EPVEK+++D+K++ K 
Sbjct: 364 KRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKE 423

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +I +IV+VGGSTRIPK+Q LLQ+FFNGKE
Sbjct: 424 KIDEIVMVGGSTRIPKIQSLLQNFFNGKE 452



 Score = 84.2 bits (199), Expect = 9e-17
 Identities = 43/72 (59%), Positives = 44/72 (61%)
 Frame = +3

Query: 501 KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
           K  NKSINPDE           ILHGDKSE  QD           G+ETAGGVMT  IKR
Sbjct: 451 KELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKR 510

Query: 681 NTTIPTKQTQTF 716
           NTTIPTKQTQTF
Sbjct: 511 NTTIPTKQTQTF 522


>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  124 bits (300), Expect = 5e-29
 Identities = 58/91 (63%), Positives = 74/91 (81%)
 Frame = +1

Query: 238  EGKEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDK 417
            + K  LS+  QA +EI+S FEG DF   +TRARFEELNA LF+ST++PV+K L DA + K
Sbjct: 966  KAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKK 1025

Query: 418  AQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
            ++IH+IVLVGGSTRIPKVQ+L++DFF GKEP
Sbjct: 1026 SEIHEIVLVGGSTRIPKVQQLVKDFFEGKEP 1056



 Score =  110 bits (265), Expect = 1e-24
 Identities = 46/87 (52%), Positives = 68/87 (78%)
 Frame = +2

Query: 11   RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
            +N+L+FDLGGGTFDVS+LTI++G+FEV +T GDTHLGGEDFD  ++ HF++ +K+K  K+
Sbjct: 890  KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKN 949

Query: 191  LATNKRALRRLRTACERAKRTCHRPHK 271
            +  + RA+++LR   E+AKR     H+
Sbjct: 950  IRKDNRAVQKLRREVEKAKRALSTQHQ 976



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 29/72 (40%), Positives = 37/72 (51%)
 Frame = +3

Query: 501  KGANKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKR 680
            K  ++ INPDE           +L G+  E+  +           GIET GGVMT LI R
Sbjct: 1054 KEPSRGINPDEAVAYGAAVQAGVLGGE--EDTGEVVLLDVNPLTLGIETVGGVMTKLISR 1111

Query: 681  NTTIPTKQTQTF 716
            NT IPTK++Q F
Sbjct: 1112 NTVIPTKKSQVF 1123


>SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 43/77 (55%), Positives = 60/77 (77%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLA 196
           + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+LGGEDFDN ++   + EFK++   DL+
Sbjct: 2   IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLS 61

Query: 197 TNKRALRRLRTACERAK 247
            +  AL+RLR A E+AK
Sbjct: 62  KDSMALQRLREAAEKAK 78



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = +1

Query: 238 EGKEDLSSSTQASIEIDSLFEGID----FYTSITRARFEELNADLFRSTMEPVEKSLRDA 405
           + K +LSSS Q  I +  +             ++R++FE L ADL   T+ P +K L+DA
Sbjct: 76  KAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDA 135

Query: 406 KMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           +++K +I D++LVGG TR+PKVQ+ +QD F G+ P
Sbjct: 136 EINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVP 169



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 30/69 (43%), Positives = 37/69 (53%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           +K++NPDE           +L GD    V+D           GIET GGV T LI RNTT
Sbjct: 170 SKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTT 225

Query: 690 IPTKQTQTF 716
           IPTK++Q F
Sbjct: 226 IPTKKSQVF 234


>SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)
          Length = 437

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 36/94 (38%), Positives = 66/94 (70%), Gaps = 5/94 (5%)
 Frame = +1

Query: 244 KEDLSSSTQASIEI--DSLFEG---IDFYTSITRARFEELNADLFRSTMEPVEKSLRDAK 408
           K +L+ + + +I++   SL EG   + F  +I+R  FE +N DLF+  ++P+ + L + +
Sbjct: 299 KINLTRTNEVTIKLMLPSLSEGKKIVKFKETISRKMFETINEDLFKKVLQPIRRVLAEVE 358

Query: 409 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKEP 510
           + K ++ ++VLVGGSTR+PK+++L+Q+FF+GK P
Sbjct: 359 LPKEEVDEVVLVGGSTRVPKIRQLIQEFFDGKPP 392



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 34/93 (36%), Positives = 57/93 (61%)
 Frame = +2

Query: 14  NVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL 193
           NV++ DLGGGT DVS+L I+ G+F   + AG+  LGG+DF+ R + + +Q   +++ + L
Sbjct: 223 NVMVVDLGGGTLDVSLLNIQGGMFVTMAMAGNNRLGGQDFNARFMQYLLQLIHKRFNRQL 282

Query: 194 ATNKRALRRLRTACERAKRTCHRPHKRALR*IL 292
            T    ++RLR   E AK    R ++  ++ +L
Sbjct: 283 -TCSEDIQRLRQEVEAAKINLTRTNEVTIKLML 314


>SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 68.9 bits (161), Expect = 4e-12
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKD 190
           RNV+  D+G  +  V I     G  +V STA + +LGG DFD  +V HF QEFK KYK D
Sbjct: 253 RNVVFVDIGHSSLQVCITAFLKGQLKVLSTAVEPNLGGRDFDYVLVEHFAQEFKTKYKID 312

Query: 191 LATNKRALRRLRTACERAKR 250
           + ++ +A  +L   CE+ K+
Sbjct: 313 VHSSIKAKIKLGAECEKLKK 332



 Score = 33.5 bits (73), Expect = 0.18
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +1

Query: 256 SSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDI 435
           +++++  I I+   E  D +  + RA+FEEL ADL +    P+  +L  A+  K  + ++
Sbjct: 336 ANTSEIPINIECFMEDKDVHGRMKRAQFEELAADLLKLVEAPLRSAL--AQSGKYSVKNV 393

Query: 436 V 438
           V
Sbjct: 394 V 394


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 68.1 bits (159), Expect = 7e-12
 Identities = 31/63 (49%), Positives = 48/63 (76%)
 Frame = +1

Query: 322 ITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNG 501
           ++R++FE L ADL   T+ P +K L+DA+++K +I D++LVGG TR+PKVQ+ +QD F G
Sbjct: 53  LSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-G 111

Query: 502 KEP 510
           + P
Sbjct: 112 RVP 114



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 30/69 (43%), Positives = 37/69 (53%)
 Frame = +3

Query: 510 NKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGGVMTTLIKRNTT 689
           +K++NPDE           +L GD    V+D           GIET GGV T LI RNTT
Sbjct: 115 SKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTT 170

Query: 690 IPTKQTQTF 716
           IPTK++Q F
Sbjct: 171 IPTKKSQVF 179


>SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1019

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQ 423
           K+ LS++ +   +I+ +F+G DF   +TR   EE+  DLF     PV ++L+ A M    
Sbjct: 255 KQVLSANNEIFAQIEGVFDGKDFRVKVTREELEEMCQDLFDRVAGPVNRALKSASMTMND 314

Query: 424 IHDIVLVGGSTRIPKVQKLL 483
           I  +VLVGG  R+PKVQ  L
Sbjct: 315 IDSVVLVGGGIRVPKVQDAL 334



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +2

Query: 89  VKSTAGDTHLGGEDFDNRMVNHFVQEFKR--KYKKDLATNKRALRRLRTACERAKR 250
           +K    D  LGG   D R+ +H VQ FK+  K+K ++  + RA+ +      R K+
Sbjct: 201 IKGIGFDRTLGGHAIDMRLRDHLVQLFKKNYKFKGEVTQSSRAMAKFYKEALRVKQ 256


>SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)
          Length = 592

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 31/82 (37%), Positives = 54/82 (65%), Gaps = 5/82 (6%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKR-----KY 181
           VL++ LGG + DV++L++ +G+++V +T  D  LGG +FD  +++    +FKR     K+
Sbjct: 156 VLVYRLGGASHDVTLLSVINGMYKVLATEYDGALGGRNFDEVLLDLLANDFKRQVLLWKW 215

Query: 182 KKDLATNKRALRRLRTACERAK 247
           K D  TNKR+  +L+T+ E+ K
Sbjct: 216 KIDPLTNKRSKTKLQTSAEQCK 237



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +1

Query: 244 KEDLSSSTQASIEIDSLFEGIDFYTSITR 330
           K  LS+   A+  +DSL EGIDF   ++R
Sbjct: 237 KNILSTLESANCSVDSLCEGIDFQGQVSR 265


>SB_47390| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 15/33 (45%), Positives = 27/33 (81%)
 Frame = +1

Query: 409 MDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           + ++ +  ++LVGG+TR PK+Q+LL+++F GKE
Sbjct: 35  LKQSSMIQVILVGGATRTPKIQQLLKNYFVGKE 67


>SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3235

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +2

Query: 2    GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 133
            G   + LI D   G+F VS    E+GI ++    GD H+ G  F
Sbjct: 1424 GAHTDTLITDNQDGSFGVSYTPFEEGIHDLAVKFGDDHIPGSPF 1467



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 29   DLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDF 133
            D G GT  VS + +E+G +++     D H+ G  F
Sbjct: 1526 DNGDGTCSVSYIPVEEGDYDIHIKFADEHIPGSPF 1560



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/48 (31%), Positives = 22/48 (45%)
 Frame = +2

Query: 2    GTRRNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM 145
            GT    +I DLG G + +  +  E G   V     +TH+ G  F  R+
Sbjct: 3022 GTESKAVISDLGKGNYAIRFVPKEFGDHLVNVKFDETHIPGSPFKIRV 3069


>SB_29289| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 956

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGK 246
           LCP  ++  + GP +++E   AFA C+  GK
Sbjct: 169 LCPSPEQNGEPGPMFEREGGDAFANCVARGK 199


>SB_24074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = +1

Query: 421 QIHDIVLVGGSTRIPKVQKLLQDFFNGKE 507
           +I  + +VGGSTRIP ++ ++++ F GKE
Sbjct: 6   EIDSVEIVGGSTRIPAIKDIIKNVF-GKE 33


>SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5)
          Length = 634

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +2

Query: 17  VLIFDLGGGTFDVSILTIEDGIFEVK 94
           V I+DLG GT++++IL  E G++ ++
Sbjct: 319 VPIYDLGNGTYEMAILFHEPGVYSIR 344


>SB_8849| Best HMM Match : F-box (HMM E-Value=0.86)
          Length = 1222

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = -3

Query: 692  DGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQDSSLD-SCTISYGLVR-VN 519
            DG+V LDE  + +++SL++ G  C   + ++ + +   TV++SSL      S   VR + 
Sbjct: 1160 DGAVLLDEWNYGSNASLSSCGSTC--SESRLSYFIGQDTVEESSLSHESNGSLTRVRQIR 1217

Query: 518  RFVG 507
            +FVG
Sbjct: 1218 QFVG 1221


>SB_41892| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 382

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 145 GQPLCPGVQEEIQKGPRYQQESS*AFAYCM 234
           G  LCP  ++  + GP +++E S AFA C+
Sbjct: 218 GYKLCPLPEQNGEPGPMFEREGSDAFANCV 247


>SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015)
          Length = 600

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +2

Query: 23  IFDLGGGTFDVSILTIEDGIFEV 91
           +FDLG G+++V  L +E G++ V
Sbjct: 311 VFDLGNGSYEVLFLVMEPGVYRV 333


>SB_43375| Best HMM Match : Pneumo_att_G (HMM E-Value=3.6)
          Length = 774

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +3

Query: 27  LTSAAVPSTCPSLPSRMVSSR*NPPPATPTWEVRTL-TIAWSTTLSRSS 170
           L S+A  +T P+LP  +V+ R  PPP+T   ++ T+ T+  STT + S+
Sbjct: 97  LDSSATTTTTPTLP--IVTLR--PPPSTSVTQIVTMTTVTISTTTAMST 141


>SB_31943| Best HMM Match : ResIII (HMM E-Value=1.6)
          Length = 1053

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGKEDLSSS---TQASIEIDSLFEGIDFYTSI 324
           LCP  ++  + GP +++E   AFA C+     D++ S     AS  ID L     F T++
Sbjct: 202 LCPLPEQNGEHGPMFEREGIYAFANCVARSSSDMTRSWPLRDASDAID-LVRKYGFPTNV 260

Query: 325 TR 330
            R
Sbjct: 261 YR 262


>SB_29335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 840

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGKEDLSSS---TQASIEIDSLFEGIDFYTSI 324
           LCP  ++  + GP +++E   AFA C+     D++ S     AS  ID L     F T++
Sbjct: 140 LCPLPEQNGEHGPMFEREGIYAFANCVARSSSDMTRSWPLRDASDAID-LVRKYGFPTNV 198

Query: 325 TR 330
            R
Sbjct: 199 YR 200


>SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5)
          Length = 452

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM*EGK 246
           LCP  ++    GP +++E S AFA C+  GK
Sbjct: 206 LCPLPEQNGGPGPMFEREGSDAFANCVTRGK 236


>SB_19421| Best HMM Match : Ribosomal_L36 (HMM E-Value=0.85)
          Length = 647

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +3

Query: 96  PPPATPTWEVRTL-TIAWSTTLSRSSRGNTKRTSLPTREL 212
           PPPA  T E   L T +W+ T S + R   KRT LPT  L
Sbjct: 436 PPPAFQTDEPERLQTSSWTETASGTGREEFKRT-LPTAAL 474


>SB_50451| Best HMM Match : Avirulence (HMM E-Value=0.14)
          Length = 1085

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 7/88 (7%)
 Frame = +2

Query: 41  GTFDV-SILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDL------AT 199
           GTFD+  I+ + + I E + +    +L    +        V+ FK  Y++ L        
Sbjct: 50  GTFDIIRIVCLRESIREFRFSHFRENLSLPLYGLPANKTVVRFFKTAYERVLKFCFLKTA 109

Query: 200 NKRALRRLRTACERAKRTCHRPHKRALR 283
            ++ +R L+TACER  R     +KR +R
Sbjct: 110 YEKVMRFLKTACERVMRFLKTAYKREMR 137


>SB_40933| Best HMM Match : DUF548 (HMM E-Value=1.7)
          Length = 682

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = -1

Query: 322 LTCRSQYPQRENLSQCSLVWTMTGPLCPLTCSTQTPKSSLVGSEVLFVFPLELL 161
           L CRS+  +  N   CS+    +  +CP   + +T  SS + +  L V PLE +
Sbjct: 75  LICRSRRYRHRNGHNCSISRNSSSEICPSCRALETSLSSCLAT--LLVRPLETI 126


>SB_57167| Best HMM Match : Ribosomal_MRP8 (HMM E-Value=3)
          Length = 698

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = +2

Query: 383 WRSLSVMPRWIRLKSTILYWWVAPLVSPRCRSSCKISLMERSQQIY 520
           W  + V P W+ +  T LY      +SP+     K+S    SQQ+Y
Sbjct: 237 WLDVFVTPDWLDVFYTSLYNQRLGYLSPKFEKLVKLSGTHLSQQVY 282


>SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2070

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -2

Query: 171  LNSWTKWLTMRLSKSSP-PKWVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRLVP 1
            LN   KW+TMR +   P  +W     DF     S++  +   ++P P  K++    VP
Sbjct: 1371 LNKSMKWITMRTATLPPSTRWAYWIADFDFLSKSAIQAL---RLPVPAPKVNNMEKVP 1425


>SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 833

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +3

Query: 30  TSAAVPSTCPSLPSRMVSSR*NPPPATP 113
           T  A P   P++PSR   +R  PPP  P
Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPP 811


>SB_38784| Best HMM Match : Apo-VLDL-II (HMM E-Value=8.3)
          Length = 439

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM 234
           LCP  ++  + GP +++E S AFA C+
Sbjct: 107 LCPLPEQNGEPGPMFEREGSDAFANCV 133


>SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6)
          Length = 533

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +1

Query: 154 LCPGVQEEIQKGPRYQQESS*AFAYCM 234
           LCP  ++  + GP +++E S AFA C+
Sbjct: 74  LCPLPEQNGEPGPMFEREGSDAFANCV 100


>SB_25455| Best HMM Match : DUF948 (HMM E-Value=0.11)
          Length = 260

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +1

Query: 283 IDSLFEGIDFYTSITRARFEELNAD--LFRSTMEPVEKSLRD 402
           +DSL   +DF T+ T A F +LN      R T+  +  SL +
Sbjct: 168 LDSLAVRVDFTTNTTNALFTQLNTTDAAIRDTLSQINSSLSE 209


>SB_41979| Best HMM Match : rve (HMM E-Value=1.3e-23)
          Length = 395

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -2

Query: 555 QLHHKLRPRQG**ICWLLSIKEI 487
           QLHH++ PRQG   C  LS K +
Sbjct: 9   QLHHRVYPRQGQCFCRFLSRKPV 31


>SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3)
          Length = 312

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = +3

Query: 48  STCPSLPSRMVSSR*NPPPATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPTREL 212
           S CPSLP+    S       TP +     TI   T  + SS   T  TS PT ++
Sbjct: 46  SLCPSLPTSSTHSTSPTVQTTPAFTTSPATILPPTAKTTSS---TSSTSKPTEDV 97


>SB_8228| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 280

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/58 (22%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 316 TSITRARFEELNADLFRSTMEPVEKSLRDAKMDKAQIHDIVLVGG-STRIPKVQKLLQ 486
           T  ++ARF++   DL   T++P+ ++++    D   + +++  G    R+   + L+Q
Sbjct: 176 TEHSKARFKQQLTDLVIHTLQPIRENIQSLSKDPGLVSNVLETGAEKARLLAEETLVQ 233


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,439,306
Number of Sequences: 59808
Number of extensions: 509817
Number of successful extensions: 4130
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 3917
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4123
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1901817086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -