SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31)        46   4e-05

>SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31)
          Length = 108

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/32 (68%), Positives = 25/32 (78%)
 Frame = +3

Query: 180 IESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           +ESINSRLALVMKSGK+ LG K TLK   + K
Sbjct: 1   MESINSRLALVMKSGKFTLGLKSTLKTLRQGK 32



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L +++  +TLRQGKAKLVIIA N P LR
Sbjct: 15  GKFTLGLKSTLKTLRQGKAKLVIIANNTPQLR 46


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,742,873
Number of Sequences: 59808
Number of extensions: 410275
Number of successful extensions: 824
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 785
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 824
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2072022557
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -