SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)          130   1e-30
SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)              99   2e-21
SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                87   1e-17
SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)                 79   4e-15
SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)              38   0.006
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     35   0.075
SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                    33   0.17 
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.23 
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.93 
SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     30   2.1  
SB_41020| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024)                   29   3.7  
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.7  
SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)                  29   3.7  
SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.9  
SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)              29   4.9  
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              28   6.5  
SB_17946| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.5  
SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.5  
SB_19088| Best HMM Match : PSGP (HMM E-Value=2.5)                      28   8.6  
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               28   8.6  

>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score =  130 bits (314), Expect = 1e-30
 Identities = 63/143 (44%), Positives = 90/143 (62%)
 Frame = +1

Query: 73  YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCY 252
           Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + ER++                   
Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGNTVEVGRAAFDTDTKHFT 225

Query: 253 HIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQL 432
            +DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G  + GQTREHA+LA T GVK L
Sbjct: 226 LLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQTREHAMLAKTAGVKHL 285

Query: 433 IVGVNKMDSTEPPYSEPRFEEIK 501
           ++ VNKMD     ++E R+EEIK
Sbjct: 286 VILVNKMDDPTVKWNEERYEEIK 308


>SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)
          Length = 123

 Score =   99 bits (238), Expect = 2e-21
 Identities = 50/88 (56%), Positives = 63/88 (71%), Gaps = 2/88 (2%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQTREHA+L  +LGV QLI
Sbjct: 18  MDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAILVRSLGVTQLI 77

Query: 436 VGVNKMDSTEPPY--SEPRFEEIKKEDP 513
           V +NK+D     Y   +PR   I +++P
Sbjct: 78  VAINKLDMVVLGYHRGKPR-SMIGRQEP 104


>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 39/42 (92%), Positives = 41/42 (97%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 135
           INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+
Sbjct: 8   INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49


>SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)
          Length = 322

 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 40/60 (66%), Positives = 42/60 (70%)
 Frame = +1

Query: 133 MGKGSFKYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQ 312
           MGKGSFKYAWVLDKLKAERER         +    +     IDAPGHRDFIKNMITGTSQ
Sbjct: 1   MGKGSFKYAWVLDKLKAERERGITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 6/46 (13%)
 Frame = +3

Query: 585 NMLEPSTKMPWFKGWQVER------KEGKADGKCLIEALDAILPPA 704
           NM+  +++MPWFK W +ER      KE  A G  L E LD+ILPP+
Sbjct: 53  NMITGTSQMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPS 98


>SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)
          Length = 541

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 20/83 (24%), Positives = 40/83 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 69  VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   ++ ++++I K
Sbjct: 123 ILQNKIDLVKESQAKDQYDQILK 145


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 26/110 (23%), Positives = 44/110 (40%)
 Frame = +1

Query: 22  VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERRY 201
           +I H D+GK+T T  L+   G I         +EA  +     K     D ++ ER+R  
Sbjct: 15  IISHPDAGKTTLTEKLLLFGGAI---------QEAGAVKSNKIKKGATSDFMEIERQRGI 65

Query: 202 HNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
                 L           +D PGH+DF ++     +  D  ++++    G
Sbjct: 66  SVATSVLAFNYRDKKINILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115


>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 36/118 (30%), Positives = 50/118 (42%), Gaps = 5/118 (4%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGI--DKRTIEKF---EKEAQEMGKGSFKYAWVLDKL 177
           N+ VI HVD GKST T  L+ K G I   K    +F    K+ Q+        A  L   
Sbjct: 20  NMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRKDEQDRCITIKSTAISLYYE 79

Query: 178 KAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
             E +  Y  +    + R    L   ID+PGH DF   +       D A+++V   +G
Sbjct: 80  LPESDFEYITQPKDPKERG--FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 32/121 (26%), Positives = 47/121 (38%), Gaps = 6/121 (4%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYK--CGGIDKRTIEKFE--KEAQEMGKGSFKYAWVLDK 174
           +I + V+G+V+SGKST  G L Y     G  +  +  F    E Q     S  +  +   
Sbjct: 112 DIRMAVLGNVESGKSTLLGVLTYDELDNGQGRARLNLFRHLHEIQSGRTSSISHEILGFS 171

Query: 175 LKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTS--QADCAVLIVAAGT 348
              E       R           L   ID  GH  ++K  I G +    D A+L++A   
Sbjct: 172 CTGEVVNYSDGRSAEDVCEQSSKLITFIDLAGHHKYMKTTIFGLTGHSPDYAMLVIAGNA 231

Query: 349 G 351
           G
Sbjct: 232 G 232


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F      G +  D  VL+VAA  G      ++  ++  HA+ A       LI
Sbjct: 81  IDTPGHAAFNSMRARGANVTDIVVLVVAADDGV----KTQTVESIRHAMHAKV----PLI 132

Query: 436 VGVNKMD 456
           V +NK+D
Sbjct: 133 VAINKID 139


>SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 4303

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 2/79 (2%)
 Frame = +1

Query: 151  KYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVL 330
            +Y WV +K+  ER R Y   YC   + +   L  HI    H+    + +    Q +    
Sbjct: 2381 EYVWVHNKMVHERSRPYRCEYCGWHLASKSNLTLHIKRI-HKRTQSDTLASELQKEPLET 2439

Query: 331  IVAAG--TGEFEAGISKNG 381
            +V  G  T +   G S +G
Sbjct: 2440 VVETGDQTSKMNDGKSTDG 2458


>SB_41020| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1229

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 5/94 (5%)
 Frame = -3

Query: 324 SAISLRGSCDH-VLDEISVSRSINVVT*YLLVSNFQ---RAISIVIPT-LTLSL*FVQYP 160
           SAIS   S +  ++  ++ S  +N+ +   +  N      + S V PT +T S     YP
Sbjct: 189 SAISTTSSIESTIMASVASSIQLNITSNTTMAVNDTLRTTSTSAVFPTTITPSPNITSYP 248

Query: 159 SIFEGSFTHFXXXXXXXLDGTFVNTTTFVDQMTS 58
           S+   +  +F        D T  N TT V  +T+
Sbjct: 249 SLMTSAVGNFTSATSVVFDSTTPNATTLVPSITA 282


>SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024)
          Length = 1213

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 6/62 (9%)
 Frame = -1

Query: 500 LISSNLGSLYGGSVESILFTPTMSCLTPRVKASKAC------SRV*PFLEIPASNSPVPA 339
           L+S N   L   ++E IL TPT    +    + K C      +   P   +   NSP+P+
Sbjct: 806 LLSCNFNDLKIDNMEVILLTPTSMAASMATSSKKVCPSSAPTTTTNPTPSVTNGNSPIPS 865

Query: 338 AT 333
            T
Sbjct: 866 GT 867


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 22/61 (36%), Positives = 27/61 (44%)
 Frame = +1

Query: 13   NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
            N  ++ HVD GKST    L+   G I K +  K                 VLDKL+ ERE
Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK----------------QVLDKLQVERE 1986

Query: 193  R 195
            R
Sbjct: 1987 R 1987


>SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)
          Length = 347

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIY 75
           E+ + V+G+VD+GKST  G L +
Sbjct: 229 EVRVAVVGNVDAGKSTLLGVLTH 251


>SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 919

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = -1

Query: 629 PSLEPRHFG*RLQHVVSVPSRNGHESDSSWVVANLLDV*GSSFLISSNL 483
           P+LEP + G  L  + S  S  GH+ D+   ++ LL+      ++ S L
Sbjct: 378 PNLEPSYIGKMLATIESTLSAKGHQEDAEEFLSCLLNGIHEEMIVLSKL 426


>SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)
          Length = 203

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 2/128 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHL--IYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           NI V+GHVDSGK++    L         DK    +      ++G  SF+ A        E
Sbjct: 37  NIGVLGHVDSGKTSLAKALSTTASTASFDKNPQSQERGITLDLGFSSFQVA------LPE 90

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
             R   + +  L++         +D PGH   IK +I G      A +I   GT   E G
Sbjct: 91  HLRSAGSEHDLLQMT-------LVDCPGHASLIKTIIGG------AQIIGECGT--IEGG 135

Query: 367 ISKNGQTR 390
             ++G+ +
Sbjct: 136 FGQSGKVK 143


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH  F      G+S  D A+L+V
Sbjct: 683 IDTPGHESFSNLRSRGSSLCDMAILVV 709


>SB_17946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = -1

Query: 599 RLQHVVSVPSRNGHESDSSWVVANLLDV*GSSFLISSNLGSLYGGSVESILFTPTMSCLT 420
           + + +  +    G + + S V+ N+LDV  S+    SN  S    ++ ++LF+  + C +
Sbjct: 102 KCEWLTDIQDIKGRKLNMSLVLENILDVMQSNVTQPSNGASRNAQALSTVLFSCFVFCFS 161

Query: 419 PRVK 408
            R+K
Sbjct: 162 LRLK 165


>SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 476

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +3

Query: 573 WHGDNMLEPSTKMPWFKGWQVERKE 647
           +H DN    +   PWF+ W  +++E
Sbjct: 191 YHNDNKTHSTQTGPWFRAWSNQKRE 215


>SB_19088| Best HMM Match : PSGP (HMM E-Value=2.5)
          Length = 737

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 5/94 (5%)
 Frame = -3

Query: 324 SAISLRGSCDH-VLDEISVSRSINVVT*YLLVSNFQ---RAISIVIPT-LTLSL*FVQYP 160
           SAIS   S +  ++  ++ S  +N+ +   +  N      + S V PT +T S     YP
Sbjct: 501 SAISTTSSIESTIMASVASSIQLNITSNTTMAVNDTLRTTSTSAVFPTTITPSPNITSYP 560

Query: 159 SIFEGSFTHFXXXXXXXLDGTFVNTTTFVDQMTS 58
           S+   +  +F        D T  N TT V  +++
Sbjct: 561 SLMTSAVGNFTSATSVVFDSTTPNATTLVQSISA 594


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 20/67 (29%), Positives = 28/67 (41%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH  F      G    D  +++VAA             QT+E    A   GV  +I
Sbjct: 143 LDTPGHEAFTAMRARGAQVTDLVIIVVAADDDVMP-------QTKEAISHAQAAGV-PII 194

Query: 436 VGVNKMD 456
             +NK+D
Sbjct: 195 FAINKID 201


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,644,620
Number of Sequences: 59808
Number of extensions: 519815
Number of successful extensions: 1539
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1358
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1531
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1889780269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -