SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)             136   2e-32
SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)             128   3e-30
SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)              73   2e-13
SB_17563| Best HMM Match : DEAD (HMM E-Value=0)                        49   3e-06
SB_2247| Best HMM Match : DEAD (HMM E-Value=0)                         49   3e-06
SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)                    48   8e-06
SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017)              47   1e-05
SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017)              47   1e-05
SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            44   2e-04
SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            44   2e-04
SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_37351| Best HMM Match : DEAD (HMM E-Value=0)                        42   7e-04
SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11)            42   7e-04
SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   9e-04
SB_43842| Best HMM Match : RNB (HMM E-Value=0)                         38   0.006
SB_32980| Best HMM Match : DEAD (HMM E-Value=0)                        38   0.008
SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)            36   0.043
SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)                  36   0.043
SB_9558| Best HMM Match : DEAD (HMM E-Value=0)                         36   0.043
SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)                  34   0.100
SB_23184| Best HMM Match : Helicase_C (HMM E-Value=7.8e-23)            33   0.23 
SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.30 
SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)            30   2.1  
SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0)              29   3.7  
SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20)              29   3.7  
SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56)                  29   3.7  
SB_27380| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.9  
SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.5  
SB_3124| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.5  
SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.6  
SB_56809| Best HMM Match : DEAD (HMM E-Value=2.6e-19)                  28   8.6  
SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7)              28   8.6  

>SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score =  136 bits (328), Expect = 2e-32
 Identities = 58/85 (68%), Positives = 71/85 (83%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVDWLTE M   +FTV++MHGDM 
Sbjct: 212 QFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVASMHGDMP 271

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ERE IM+ FR G SRVLI+T  W
Sbjct: 272 QKEREAIMKDFRAGQSRVLISTDVW 296



 Score = 74.9 bits (176), Expect = 6e-14
 Identities = 39/74 (52%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DVQQVS VINYDLP+NRE Y                 NFV   D R L+DIE +Y 
Sbjct: 297 ARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYS 356

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 357 TQIDEMPMNVADLI 370


>SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 478

 Score =  128 bits (310), Expect = 3e-30
 Identities = 55/82 (67%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++ +E E+WKL+TLCDLY+TL+I QAVIF NTRRKVDWL   M  +D TVS+MHGDM 
Sbjct: 306 QFFVLVEKEDWKLDTLCDLYETLTITQAVIFANTRRKVDWLAAKMTEKDHTVSSMHGDMS 365

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q+ER++IM++FR+GSSRVLITT
Sbjct: 366 QKERDIIMKEFRSGSSRVLITT 387



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 24/26 (92%), Positives = 24/26 (92%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           LLARGIDV QVS VINYDLPSNRENY
Sbjct: 389 LLARGIDVHQVSLVINYDLPSNRENY 414


>SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)
          Length = 490

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 31/82 (37%), Positives = 49/82 (59%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+  +  E K E LC++Y  LSI Q V+FC+TRR   WL E M      V+ + G++ 
Sbjct: 320 QYYVVCKNSEDKFEALCNMYGVLSIGQCVVFCHTRRNAAWLAEKMVKEGHAVALLSGEIT 379

Query: 188 QREREVIMRQFRTGSSRVLITT 253
             +R  ++ +FR G  ++LITT
Sbjct: 380 IEQRIAVLERFRLGKEKLLITT 401



 Score = 35.1 bits (77), Expect = 0.057
 Identities = 14/22 (63%), Positives = 19/22 (86%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRE 327
           ARGIDV+QV+ VINYD+P + +
Sbjct: 405 ARGIDVEQVTLVINYDMPMDMQ 426


>SB_17563| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E+ K+  L  L+  L I Q++IFCN+ ++V+ L   +    F+   +H  M
Sbjct: 267 TQYYAFVE-EKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARM 325

Query: 185 DQREREVIMRQFRTGSSRVLI 247
            Q  R  +   FR G  R L+
Sbjct: 326 SQSHRNRVFHDFRQGHCRNLV 346



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/70 (37%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE+ 
Sbjct: 350 LFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENE 409

Query: 436 YHTSIVEMPS 465
             T I  +PS
Sbjct: 410 LDTEIKPIPS 419


>SB_2247| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E+ K+  L  L+  L I Q++IFCN+ ++V+ L   +    F+   +H  M
Sbjct: 267 TQYYAFVE-EKQKVHCLNTLFQKLQINQSIIFCNSVQRVELLARKILELGFSCFYIHARM 325

Query: 185 DQREREVIMRQFRTGSSRVLI 247
            Q  R  +   FR G  R L+
Sbjct: 326 SQSHRNRVFHDFRQGHCRNLV 346



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/70 (37%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE+ 
Sbjct: 350 LFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENE 409

Query: 436 YHTSIVEMPS 465
             T I  +PS
Sbjct: 410 LDTEIKPIPS 419


>SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)
          Length = 475

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ EAD + L +++D
Sbjct: 394 LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDEADAKTLNEVQD 453

Query: 433 FYHTSIVEMPSDV 471
            +  ++ E+P ++
Sbjct: 454 RFEVNVGELPDEI 466


>SB_58021| Best HMM Match : Helicase_C (HMM E-Value=0.017)
          Length = 91

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/70 (37%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE+ 
Sbjct: 2   LFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENE 61

Query: 436 YHTSIVEMPS 465
             T I  +PS
Sbjct: 62  LDTEIKPIPS 71


>SB_24297| Best HMM Match : Helicase_C (HMM E-Value=0.017)
          Length = 91

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 26/70 (37%), Positives = 32/70 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE+ 
Sbjct: 2   LFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRFGHLGVAINLITYDDRFDLYKIENE 61

Query: 436 YHTSIVEMPS 465
             T I  +PS
Sbjct: 62  LDTEIKPIPS 71


>SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 445

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 71  TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLIT 250
           +L + Q +IF   +  VD + E + L+     A+HGD  Q ER   +R+F  G+  VL+ 
Sbjct: 84  SLDVIQVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVA 143

Query: 251 T 253
           T
Sbjct: 144 T 144



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   +  VIN+D+P + ENY
Sbjct: 148 SKGLDFPDIQHVINFDMPEDIENY 171


>SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 212

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 71  TLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLIT 250
           +L + Q +IF   +  VD + E + L+     A+HGD  Q ER   +R+F  G+  VL+ 
Sbjct: 84  SLDVIQVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVA 143

Query: 251 T 253
           T
Sbjct: 144 T 144



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   +  VIN+D+P + ENY
Sbjct: 148 SKGLDFPDIQHVINFDMPEDIENY 171


>SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +2

Query: 74  LSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +S    +IF   +   + L  ++   DF V+ +HGDMDQ ER  ++ QF+     +L+ T
Sbjct: 727 ISAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVAT 786


>SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1375

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41   KLETLCDLYDTLSIAQ-AVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
            K   L DL +     Q  ++F  T++  D L   +    +  +++HGD  QRERE  +R 
Sbjct: 1086 KRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRT 1145

Query: 218  FRTGSSRVLITT 253
            FR G + +L+ T
Sbjct: 1146 FRCGDTPILVAT 1157



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/68 (29%), Positives = 31/68 (45%)
 Frame = +1

Query: 262  ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
            ARG+D+  V  VIN+DLP++ E Y                 +F    ++   K++ D   
Sbjct: 1161 ARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNKNVAKELMDILE 1220

Query: 442  TSIVEMPS 465
             S  E+PS
Sbjct: 1221 ESKQEIPS 1228


>SB_37351| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 688

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 19/56 (33%), Positives = 34/56 (60%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + +IF  T+++ + L  +  L+  T   +HGD+ Q++REV ++ FR G  R L+ T
Sbjct: 307 RTMIFAQTKKEANELALNSVLKQET-QVLHGDIPQKQREVTLKSFREGKFRCLVAT 361


>SB_21307| Best HMM Match : Helicase_C (HMM E-Value=1.7e-11)
          Length = 87

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVT-EADRRALKDIED 432
           L  RG+D+++V+ V NYD+P + + Y                  FV+ EAD + L +++D
Sbjct: 21  LFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDEADAKTLNEVQD 80

Query: 433 FYHTSI 450
            +  ++
Sbjct: 81  RFEVNV 86


>SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1170

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +2

Query: 41   KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
            K + L  +       + ++F  ++R  D+L   +    F  +++HGD  Q+ERE  +  F
Sbjct: 949  KRDRLTQILGDAGTDRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDF 1008

Query: 221  RTGSSRVLITT 253
            R G   VLI T
Sbjct: 1009 RKGRCPVLIAT 1019



 Score = 33.1 bits (72), Expect = 0.23
 Identities = 13/24 (54%), Positives = 18/24 (75%)
 Frame = +1

Query: 262  ARGIDVQQVSCVINYDLPSNRENY 333
            ARG+D+  V  VIN+DLPS+ + Y
Sbjct: 1023 ARGLDIDDVKHVINFDLPSDIDEY 1046


>SB_43842| Best HMM Match : RNB (HMM E-Value=0)
          Length = 1238

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 18/71 (25%), Positives = 35/71 (49%)
 Frame = +2

Query: 41  KLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQF 220
           K + L +   T      ++F ++ + VD++TE +    F  S +H +  Q  R  +++ F
Sbjct: 319 KPQKLLETLRTTPYPPVIVFTSSIQNVDYVTELLKQEQFHASGLHSEKPQDYRFKLVKAF 378

Query: 221 RTGSSRVLITT 253
           R G   +L+ T
Sbjct: 379 RDGKVDILVAT 389



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D  +V+ VINYDLP   E Y
Sbjct: 393 SRGLDFPEVTHVINYDLPDTIECY 416


>SB_32980| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 985

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L ARGID + V+ V+N D+P N E Y                  +V    + R L+DIE 
Sbjct: 273 LTARGIDAENVNLVVNMDVPHNGETYLHRIGRAGRFGTEGMAVTYVANGKEERELRDIER 332

Query: 433 FYHTSIVEMPSDVANLI 483
                +  +P+ + + +
Sbjct: 333 SIDVKMELLPAHIPDTL 349


>SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)
          Length = 1058

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           E  KL  + D+         +IF  ++ +   L   +      V  +H D  Q +R+ I+
Sbjct: 367 ESGKLLAVRDIVQKGFTPPVLIFVQSKDRAKELFHELIYDGINVDVIHSDRTQAQRDNIV 426

Query: 212 RQFRTGSSRVLITT 253
           + FRTG   VLI T
Sbjct: 427 KSFRTGKIWVLIAT 440



 Score = 31.1 bits (67), Expect = 0.93
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L+ RGID + V+ VINYD P++   Y
Sbjct: 442 LMGRGIDFKGVNLVINYDFPTSAVAY 467


>SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)
          Length = 428

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +1

Query: 265 RGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYHT 444
           RGID++ VS VINYD+    E+Y                 +F+T++D     D++    +
Sbjct: 346 RGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLTQSDSGVFYDLKQLLLS 405

Query: 445 S 447
           S
Sbjct: 406 S 406



 Score = 28.7 bits (61), Expect = 4.9
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +2

Query: 149 RDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + F  + +HG  +Q +RE  +   + GS  +L+ T
Sbjct: 307 KKFRATTLHGGRNQEQREFALSSLKGGSKDILVAT 341


>SB_9558| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 436

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           +RG+D+ QV  V+N ++P++ ++Y                 + VT+ D   +K IE+  +
Sbjct: 308 SRGLDIPQVELVVNSNIPADPKDYIHRVGRTARAGRGGMAISMVTQYDIDRVKKIEEKIN 367

Query: 442 TSIVE 456
           T + E
Sbjct: 368 TKLTE 372


>SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)
          Length = 978

 Score = 34.3 bits (75), Expect = 0.100
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 41  KLETLCDLY--DTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           K E + +L   D+ S  Q ++FCN+    DWL   +   + ++  +HG++
Sbjct: 639 KAERIVELLKKDSKSPGQTIVFCNSASSCDWLARHLEQHNLSLIRLHGNI 688



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           + +RG+D   VS VIN+D P++  +Y
Sbjct: 755 IASRGLDTSDVSHVINFDFPNSMVDY 780


>SB_23184| Best HMM Match : Helicase_C (HMM E-Value=7.8e-23)
          Length = 226

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +2

Query: 146 LRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           L    V A+H  +D  E++++M +F  G S+VLI+T
Sbjct: 90  LAGLRVEALHSRLDSSEKDLVMDRFIKGESQVLIST 125


>SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRA 414
           +RG+D++ ++ VINYD P + E+Y                  F++  D R+
Sbjct: 103 SRGLDIKDITYVINYDFPRHIEDYVHRVGRTGRAGRSGTSLTFISREDWRS 153


>SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)
          Length = 331

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 11/22 (50%), Positives = 18/22 (81%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSN 321
           ++ARG+D+ +V+ VI YD PS+
Sbjct: 149 VMARGVDIPEVNWVIQYDPPSS 170


>SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 697

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 15/56 (26%), Positives = 28/56 (50%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F NT   V  LT  + L       +H  M QR+R   + +F+  ++ +L+ T
Sbjct: 458 RTLVFANTIDCVRRLTSILRLVQLNPLPLHASMQQRQRLKNLDRFKASNTGLLLAT 513


>SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 8   ETSVLARGLTFCPTPRKIDWSQVNADIYDF 37


>SB_28158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 256

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 87  ETSVLARGLTFCPTPRKIDWSQVNADIYDF 116


>SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0)
          Length = 1559

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 87  ETSVLARGLTFCPTPRKIDWSQVNADIYDF 116


>SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 87  ETSVLARGLTFCPTPRKIDWSQVNADIYDF 116


>SB_30394| Best HMM Match : Helicase_C (HMM E-Value=1e-20)
          Length = 556

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +1

Query: 253 CLLARGIDVQQVSCVINYDLPSNRENY 333
           C L  G+D+  V  +I++ +PS  E+Y
Sbjct: 319 CALGMGVDIPDVDHIIHFGIPSEVEHY 345


>SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56)
          Length = 785

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 287 ETSVLARGLTFCPTPRKIDWSQVNADIYDF 316


>SB_27380| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 509

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 8   ETSVLARGLTFCPTPRKIDWSQVNADIYDF 37


>SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1455

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 68  DTLSIAQAVIFCNTRRKVDWLTESMHLRDF 157
           +T  +A+ + FC T RK+DW   +  + DF
Sbjct: 51  ETSVLARGLTFCPTPRKIDWSQVNADIYDF 80


>SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 427

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 500 FRFYSVSCVLLRYL*G--VCIRTRLLTT*HCRIFIGTYFIWTDIFILDLINEYTI 658
           FRF+ V+ VL   L G  V + T +      ++F+  YF+  ++ I +LIN  TI
Sbjct: 23  FRFFLVALVLSASLVGNAVVVHTAITARQQTKVFL--YFLVANLSIAELINTCTI 75


>SB_21060| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 845

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +2

Query: 134 ESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSS-RVLITT 253
           E M LR    S   G M QRE+E ++ +FR GS   ++I T
Sbjct: 583 ELMPLRLVGNSDGRGGMTQREQEEVIAKFRAGSECNIIIAT 623


>SB_3124| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 767

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = +1

Query: 439 HTSIVEMPSDVANLI*GAYIFPILFCVLRSIAIF 540
           H  I  +P DV  L  G  IF ILF +L +  +F
Sbjct: 411 HERIDSLPHDVDRLFAGTLIFTILFFLLPTTTLF 444


>SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1931

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = -2

Query: 324  TVGWQIIVDDAGNLLYINTTCQ*TVVIKT 238
            T G   I++  GN  +INT C  T VI T
Sbjct: 1040 TAGNSTIINTTGNPTFINTLCNSTFVIAT 1068


>SB_56809| Best HMM Match : DEAD (HMM E-Value=2.6e-19)
          Length = 1463

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 11/20 (55%), Positives = 17/20 (85%)
 Frame = +2

Query: 194 EREVIMRQFRTGSSRVLITT 253
           E+EVI++ FRTG  ++LI+T
Sbjct: 605 EQEVILKSFRTGRIKLLIST 624


>SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7)
          Length = 325

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +3

Query: 60  TCMIHCLLHKL*FSATPVARWIG 128
           T  + C+L +  FSA P +RW+G
Sbjct: 281 TARVSCMLQREMFSAFPCSRWLG 303


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,298,254
Number of Sequences: 59808
Number of extensions: 434876
Number of successful extensions: 884
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 802
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 880
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1889780269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -