SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.028
SB_29357| Best HMM Match : LRR_1 (HMM E-Value=0.00026)                 34   0.15 
SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.60 
SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7)             31   0.79 
SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98)                 31   0.79 
SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)                   31   1.0  
SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48)               31   1.4  
SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.)                 30   1.8  
SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27)                   29   3.2  
SB_34673| Best HMM Match : UK (HMM E-Value=0.6)                        29   3.2  
SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_19618| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_42880| Best HMM Match : Laminin_II (HMM E-Value=2.1)                29   5.6  
SB_38815| Best HMM Match : Laminin_II (HMM E-Value=1.3)                29   5.6  
SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2)                      29   5.6  
SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.4  
SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             28   7.4  
SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41)                   28   7.4  
SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.4  
SB_47219| Best HMM Match : DUF414 (HMM E-Value=1.7)                    28   7.4  
SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013)                 28   7.4  
SB_20304| Best HMM Match : Vicilin_N (HMM E-Value=4.6)                 28   7.4  

>SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 306

 Score = 36.3 bits (80), Expect = 0.028
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 9/89 (10%)
 Frame = +2

Query: 512 EISKEE--KPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIP-------EIKTPEA 664
           E S+EE  KPS  D       A   P   K+ +     E+     P       E++ P+ 
Sbjct: 196 EASEEEEGKPSLEDGTEDTPEANKTPEEPKEDEKVTEEETPKEETPKVEDAPEEVEAPKE 255

Query: 665 ADAPKLADNPVDEDKPADISPDAPKAEAK 751
            ++PK  D P +ED P +   D PK EAK
Sbjct: 256 EESPKEEDTPKEEDAPKE---DTPKEEAK 281


>SB_29357| Best HMM Match : LRR_1 (HMM E-Value=0.00026)
          Length = 521

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 662 AADAPKLADNPVDEDKPADISPDAPKAEAKSADD 763
           A D+ K  + P DED+P D+ P  P +++K ADD
Sbjct: 425 AVDSAKKEEPPKDEDQPGDVEP--PISDSKDADD 456


>SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1143

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = +3

Query: 435 KSADIKVEEPAAQPEDSKTEVQ---ATVLKFQKKKNLVLLMQKVLPTQLPSFPTW 590
           ++ DI VE PA+    +KTE +   A + KF++ +    L+ +VL +  P+ PT+
Sbjct: 781 RNEDIVVEVPASNEPAAKTEDEIRKAEMCKFEQAQEAEDLISEVLKSYAPTLPTY 835


>SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7)
          Length = 241

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 1/73 (1%)
 Frame = +2

Query: 548 AEGSADSAAIIPNMVKKIDLAPTVES-DAAAIPEIKTPEAADAPKLADNPVDEDKPADIS 724
           AE S  + A+ P    +   +P  E+ D    PE K    A APK  D P  E       
Sbjct: 30  AEASDATEAVAP----EAPASPESENTDDFKEPEAKEETPAAAPKAEDTPALETSGESKL 85

Query: 725 PDAPKAEAKSADD 763
           PD P  + +S DD
Sbjct: 86  PDTPVEDEESEDD 98


>SB_9150| Best HMM Match : PspA_IM30 (HMM E-Value=0.98)
          Length = 242

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 EIPDAEAKSADIKVEEPAAQPEDSKTEVQATV 509
           E P  EA+S D KVE P  + E  + EV+ATV
Sbjct: 22  ETPIEEAESPDKKVEAPIEEAEAPEEEVEATV 53


>SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)
          Length = 1074

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 24/83 (28%), Positives = 33/83 (39%), Gaps = 2/83 (2%)
 Frame = +2

Query: 509 AEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEA--ADAPKL 682
           A    + +P    A G  D+    P   K  D A   E +A+        EA   +A K 
Sbjct: 107 ATADNKAEPKKEQASGIKDAPEATPK--KGADKATPKEVEASGDEVASEAEAKPVEAAKT 164

Query: 683 ADNPVDEDKPADISPDAPKAEAK 751
             NP  EDKPA+ + +     AK
Sbjct: 165 ESNPAKEDKPAEKAKEDKAGPAK 187


>SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48)
          Length = 341

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = +2

Query: 539 ATDAEGSAD-SAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPA 715
           A D   SA+   +I P++ + +DL   +E D   +P+I T   A  P     P D   PA
Sbjct: 246 ADDLAYSAELGPSIAPSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVP--PPPPADGSAPA 303

Query: 716 DISPDAP 736
              P  P
Sbjct: 304 PPPPPPP 310


>SB_42| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1207

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 584  NMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDA 733
            N V   DL  T+ ++ + +P     E  D P  +D P     P D+SP++
Sbjct: 909  NKVTNSDL--TINTNQSTLPREPVNEGYDNPTFSDYPDGSPSPKDVSPES 956


>SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27)
          Length = 5087

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 494  STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPT 616
            +TS  AE+ +E KP+A D + SA S     ++   I+++PT
Sbjct: 1142 ATSLEAEVFEEYKPTAKDVKESASSTV---HLAADIEISPT 1179


>SB_34673| Best HMM Match : UK (HMM E-Value=0.6)
          Length = 641

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 2/71 (2%)
 Frame = +2

Query: 542 TDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEI--KTPEAADAPKLADNPVDEDKPA 715
           TD    +      P+  ++ + AP         P+   KT +  D P  A +  D  + A
Sbjct: 249 TDVPDRSQEVTNTPDRPQEANDAPDRPEKTIDAPDRSQKTTDTPDRPHEATDEPDRSQEA 308

Query: 716 DISPDAPKAEA 748
           D +PD P+ EA
Sbjct: 309 DDTPDRPQKEA 319


>SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 428

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 578 IPNMVKKIDLAPTVESDA-AAIPEIKTPEAADAPKLADNPVDEDKPADI 721
           +P  VK++   P  + +       +K P  A AP     P D DKPA +
Sbjct: 338 VPEPVKEVPARPVTKQEPFKQTKPVKEPSLAPAPTANMVPSDRDKPAGL 386


>SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1271

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 3/77 (3%)
 Frame = +2

Query: 545 DAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADIS 724
           DA G +     +P     I  A  ++ D A    I +   + APKL DN   E +   ++
Sbjct: 310 DATGESGDEDFLPG---SIGGATNLQQDEAKAQTISSGSGSAAPKLTDNAAKEVQQTPVA 366

Query: 725 PDA---PKAEAKSADDL 766
             A    KA  K+A D+
Sbjct: 367 QAAEVVAKAPVKAAKDV 383


>SB_19618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 530

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 14/50 (28%), Positives = 24/50 (48%)
 Frame = +2

Query: 623 SDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSADDLRL 772
           S ++ + + +  E  D P + D   +ED+  +  P+ P  E   AD L L
Sbjct: 362 STSSEMSDFEDEEGVDEPVMDDENEEEDQDDEKPPENPLTEEMLADSLSL 411


>SB_42880| Best HMM Match : Laminin_II (HMM E-Value=2.1)
          Length = 647

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLA-PTVESDAAAIPEIKTPEAAD 670
           S SYR   SK +  ++  A+  AD +A I  +   +  A P+       +  + TP+A +
Sbjct: 3   SKSYRTR-SKSKSQTSNVAQEIADRSAQIEELQMSLPSASPSHAGAQQRVAPLLTPQAIE 61

Query: 671 APKLA 685
           AP LA
Sbjct: 62  APSLA 66


>SB_38815| Best HMM Match : Laminin_II (HMM E-Value=1.3)
          Length = 303

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +2

Query: 494 STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKI-DLAPTVESDAAAIPEIKTPEAAD 670
           S SYR   SK +  ++  A+  AD +A I  +   +  ++P+       +  + TP+A +
Sbjct: 3   SKSYRTR-SKSKSQTSNVAQEIADLSAQIEELQMSLPSVSPSHAGAQQRVAPLLTPQAIE 61

Query: 671 APKLA 685
           AP LA
Sbjct: 62  APSLA 66


>SB_24403| Best HMM Match : BRF1 (HMM E-Value=1.2)
          Length = 623

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 2/75 (2%)
 Frame = +2

Query: 527 EKPSATDAEGSADSAAIIPNMVKKIDLAPT--VESDAAAIPEIKTPEAADAPKLADNPVD 700
           E  S  ++E S +++A      K      T   +SD   + EI + +  D+ K++ NP D
Sbjct: 130 EVASEENSEKSIETSAASETATKSPSTENTGSTKSDKDDVVEISSDD--DSDKISANPTD 187

Query: 701 EDKPADISPDAPKAE 745
             +P D++   P ++
Sbjct: 188 VQEPMDLTAPKPDSD 202


>SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1256

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = +2

Query: 608  APTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDA 733
            AP  + D+ A P    PE A+     DNP + +KP ++S ++
Sbjct: 1211 APASQEDSQAQPTETKPEGAE-----DNPENAEKPGEVSKES 1247


>SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)
          Length = 6725

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = -1

Query: 341 VFWGYIVLFGLWYSGYLVVTNWS-RFGFLLSVAAATSVGLTESSILGA 201
           V W  +  F  W+     VT+    FGF +S A+A S+G +  +  GA
Sbjct: 564 VDWAQVQAFSKWFISQSAVTDQGVHFGF-ISYASAASIGFSFDADTGA 610


>SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41)
          Length = 638

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 2/80 (2%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESD--AAAIPEIKTPEAADAPKLADN 691
           SKE+KP A   +   +  A +P++       P + SD      P+ + P    AP L   
Sbjct: 418 SKEKKPPAPLPKAHNEKIAPLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPL 477

Query: 692 PVDEDKPADISPDAPKAEAK 751
           P+  + P       P    K
Sbjct: 478 PLPPELPGSPGDSPPATSPK 497


>SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1438

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 408 SSEIPDAEAKSADIKVEEPAAQPEDSKTEVQATV 509
           ++E+P  +A ++  + E PAA+PE +  E +A V
Sbjct: 587 TAEVPIEDADTSTEEAESPAAEPEVAVKEAEAPV 620


>SB_47219| Best HMM Match : DUF414 (HMM E-Value=1.7)
          Length = 704

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 3/54 (5%)
 Frame = +2

Query: 602 DLAPTVESDAAAIPEIKTPEAADAPKLADNPVD---EDKPADISPDAPKAEAKS 754
           D     +  A   P++KT   AD P  A  P D   +++P D   +  K   KS
Sbjct: 610 DRKKQTDETAVESPDVKTASEADQPVEAKKPADKSAKEEPKDAKAEDSKESLKS 663



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 647 IKTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSAD 760
           +++P+   A + AD PV+  KPAD S      +AK+ D
Sbjct: 620 VESPDVKTASE-ADQPVEAKKPADKSAKEEPKDAKAED 656


>SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013)
          Length = 440

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = +2

Query: 536 SATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLA--DNPVDEDK 709
           S++D + S+D    +    KK     + E D+++  E   P+  DA K A  D+  D+D 
Sbjct: 66  SSSDDDSSSDEEVKVKKDTKKATKGSSSEDDSSSDEEEVKPKK-DAKKAATEDSSSDDDS 124

Query: 710 PADISPDAPKAEAK 751
             +   + PK + +
Sbjct: 125 SGEDEDEKPKKKVE 138


>SB_20304| Best HMM Match : Vicilin_N (HMM E-Value=4.6)
          Length = 261

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 18/46 (39%), Positives = 21/46 (45%)
 Frame = +2

Query: 614 TVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEAK 751
           T  ++A   PE   PE     K  D P  EDKP D   D P+ E K
Sbjct: 92  TTRNNADEKPE-DNPEDTPEDKTEDRP--EDKPEDKQQDKPEPEKK 134


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,074,542
Number of Sequences: 59808
Number of extensions: 360298
Number of successful extensions: 1542
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1534
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2131907602
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -