SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                97   2e-20
SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)           90   2e-18
SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)                 84   1e-16
SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)              82   5e-16
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     38   0.008
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.011
SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                    37   0.019
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               33   0.033
SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)              35   0.060
SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)                  35   0.079
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.32 
SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39)                   30   1.7  
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              30   2.2  
SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.2  
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.2  
SB_13334| Best HMM Match : CRA_rpt (HMM E-Value=5.1)                   29   5.2  
SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)              28   6.8  
SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.8  
SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13)                   28   9.0  
SB_15368| Best HMM Match : POPLD (HMM E-Value=1.3)                     28   9.0  
SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     28   9.0  
SB_15835| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.0  

>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 44/48 (91%), Positives = 45/48 (93%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQE 255
           M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E
Sbjct: 1   MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSE 48


>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 41/105 (39%), Positives = 65/105 (61%)
 Frame = +1

Query: 196 YKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGITIDIALWKFETSKYYVT 375
           Y  G +DKRT+EK+E+EA+E  ++   +       +     G T+++    F+T   + T
Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGNTVEVGRAAFDTDTKHFT 225

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQT 510
           ++DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G  + GQT
Sbjct: 226 LLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQT 270



 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 27/52 (51%), Positives = 40/52 (76%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNP 665
           REHA+LA T GVK L++ VNKMD     ++E R+EEIK +++ ++KK+G+NP
Sbjct: 271 REHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFNP 322


>SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)
          Length = 322

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 37/39 (94%), Positives = 38/39 (97%)
 Frame = +1

Query: 319 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 435
           GITIDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ
Sbjct: 22  GITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60



 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 21/21 (100%), Positives = 21/21 (100%)
 Frame = +3

Query: 255 MGKGSFKYAWVLDKLKAERER 317
           MGKGSFKYAWVLDKLKAERER
Sbjct: 1   MGKGSFKYAWVLDKLKAERER 21


>SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)
          Length = 123

 Score = 81.8 bits (193), Expect = 5e-16
 Identities = 35/61 (57%), Positives = 46/61 (75%)
 Frame = +1

Query: 328 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 507
           +D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQ
Sbjct: 1   MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60

Query: 508 T 510
           T
Sbjct: 61  T 61



 Score = 35.5 bits (78), Expect = 0.045
 Identities = 15/23 (65%), Positives = 19/23 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMD 578
           REHA+L  +LGV QLIV +NK+D
Sbjct: 62  REHAILVRSLGVTQLIVAINKLD 84


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 25/110 (22%), Positives = 46/110 (41%)
 Frame = +1

Query: 145 VIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGI 324
           +I H D+GK+T T  L+   G I +    K  K  +    D            +    GI
Sbjct: 15  IISHPDAGKTTLTEKLLLFGGAIQEAGAVKSNKIKKGATSDFM---------EIERQRGI 65

Query: 325 TIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           ++  ++  F      + I+D PGH+DF ++     +  D  ++++    G
Sbjct: 66  SVATSVLAFNYRDKKINILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 37.5 bits (83), Expect = 0.011
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 9/125 (7%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYK--CGGIDKRTIEKF----EKEAQEWVKDPSNMLGY 288
           T I + V+G+V+SGKST  G L Y     G  +  +  F    E ++         +LG+
Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTYDELDNGQGRARLNLFRHLHEIQSGRTSSISHEILGF 170

Query: 289 -WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTS--QADCAVLIV 459
             T   ++ S G + +      E S   +T ID  GH  ++K  I G +    D A+L++
Sbjct: 171 SCTGEVVNYSDGRSAEDVC---EQSSKLITFIDLAGHHKYMKTTIFGLTGHSPDYAMLVI 227

Query: 460 AAGTG 474
           A   G
Sbjct: 228 AGNAG 232


>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 7/128 (5%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           M K+    N+ VI HVD GKST T  L+ K G I     +  E    +  KD  +     
Sbjct: 12  MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGII--AAAKAGETRFTDTRKDEQDRC--I 67

Query: 292 TN*RLSVSVGITIDIALWKFETSK-------YYVTIIDAPGHRDFIKNMITGTSQADCAV 450
           T    ++S+   +  + +++ T         + + +ID+PGH DF   +       D A+
Sbjct: 68  TIKSTAISLYYELPESDFEYITQPKDPKERGFLINLIDSPGHVDFSSEVTAALRVTDGAL 127

Query: 451 LIVAAGTG 474
           ++V   +G
Sbjct: 128 VVVDCVSG 135


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 32.7 bits (71), Expect(2) = 0.033
 Identities = 15/51 (29%), Positives = 22/51 (43%)
 Frame = +1

Query: 313 SVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           S GIT  I  +  +     +  +D PGH  F      G    D  +++VAA
Sbjct: 121 SGGITQHIGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAA 171



 Score = 22.2 bits (45), Expect(2) = 0.033
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = +1

Query: 139 IVVIGHVDSGKSTTTGHL 192
           + V+GHVD GK++   ++
Sbjct: 94  VTVMGHVDHGKTSLLDYI 111


>SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)
          Length = 203

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 36/133 (27%), Positives = 57/133 (42%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K+ +   + NI V+GHVDSGK++    L          +   F+K  Q   +  +  LG+
Sbjct: 28  KIKERILNFNIGVLGHVDSGKTSLAKAL------STTASTASFDKNPQSQERGITLDLGF 81

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                 S  V +   +     E     +T++D PGH   IK +I G      A +I   G
Sbjct: 82  -----SSFQVALPEHLRSAGSEHDLLQMTLVDCPGHASLIKTIIGG------AQIIGECG 130

Query: 469 TGEFEAGISKNGQ 507
           T   E G  ++G+
Sbjct: 131 T--IEGGFGQSGK 141


>SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)
          Length = 347

 Score = 34.7 bits (76), Expect = 0.079
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 9/107 (8%)
 Frame = +1

Query: 133 INIVVIGHVDSGKST-----TTGHLIYKCGGIDKRTI-EKFEKEAQEWVKDPSNMLGYWT 294
           + + V+G+VD+GKST     T G L    G   +R    K E E+       +++LG+  
Sbjct: 230 VRVAVVGNVDAGKSTLLGVLTHGELDNGRGTARQRLFRHKHEMESGRTSSVGNDILGFDN 289

Query: 295 N*RL---SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITG 426
             ++   +   G  +D A    E+SK  +T ID  GH  ++K  I G
Sbjct: 290 TGQVVNKAEQHGANVDWAKICKESSK-VITFIDLAGHERYLKTTIFG 335


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T ID PGH  F      G +  D  VL+VAA  G
Sbjct: 78  ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDG 112


>SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39)
          Length = 2865

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = -1

Query: 81  FHFFTSQNNFFDTHHGLQTACNIRLV 4
           F+FF+  NN F T HG+ TA  ++LV
Sbjct: 29  FYFFSLINNNFTTKHGIATAVLLQLV 54


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           IID PGH  F      G+S  D A+L+V
Sbjct: 682 IIDTPGHESFSNLRSRGSSLCDMAILVV 709


>SB_26228| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1128

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%)
 Frame = +1

Query: 172 STTTGHLIYKCGGIDK----RTIEKFEKEAQEWVKDPSNML 282
           +T  G LIY  GG D      ++E ++ +A+ W K+  NML
Sbjct: 292 ATVHGGLIYVLGGRDNDADLSSVEVYDPKAKTWSKEELNML 332


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +1

Query: 136  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 234
            N  ++ HVD GKST    L+   G I K +  K
Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975


>SB_13334| Best HMM Match : CRA_rpt (HMM E-Value=5.1)
          Length = 398

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = +1

Query: 154 HVDSGKSTTTGHLIYKCGGIDKRTI--EKFEKEAQEWVKDPSNMLGYWTN*RLSVSVGIT 327
           HV   +S TT     +   I K T+   K  KE++ W+ +PSN  GYW   +L+ +V I 
Sbjct: 88  HVAEDRSFTT-----RVRDIFKETVVTHKSAKESRRWLSEPSN--GYWPQ-QLNFAVWIL 139

Query: 328 IDI 336
            ++
Sbjct: 140 YEL 142


>SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)
          Length = 541

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 379 IDAPGHRDFIKNMITGTSQADCAVLIVA 462
           +D PGH   +  M+ G +  D A+L++A
Sbjct: 69  VDCPGHDILMATMLNGAAVMDAALLLIA 96


>SB_23862| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3112

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%)
 Frame = +3

Query: 579  STEPPYSEPRFEEIKKE----VSSYIKKIGYNPA-AVAFVPISGWHGDNMLE 719
            ST    S+  FE  KK      +S+ K    +P+  + FVP   WHG+ M+E
Sbjct: 1062 STRANSSQGGFEAKKKSWTKLSASFAKPEVVDPSDKIRFVPAVNWHGEQMIE 1113


>SB_44978| Best HMM Match : REJ (HMM E-Value=3.9e-13)
          Length = 1819

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = -3

Query: 286  TQAYLKDPLPIPGPPSRTSRWYVCQYHHIC 197
            T  Y   P  +PG  S   +W +C+Y+  C
Sbjct: 1229 TSLYCSCPTCLPGSGSLEMKWSICKYNGSC 1258


>SB_15368| Best HMM Match : POPLD (HMM E-Value=1.3)
          Length = 306

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
 Frame = +1

Query: 154 HVDSGKSTTTGHLIYKCGGIDKRTI--EKFEKEAQEWVKDPSNMLGYW 291
           HV   KS TT     +   I K T+   K  KE++ W+ DPS   GYW
Sbjct: 118 HVAEDKSFTT-----RVRDIFKETVVTHKSAKESRRWLSDPS--YGYW 158


>SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 4303

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +3

Query: 273  KYAWVLDKLKAERERRYHNRYCSLEVRN*QVLCYH 377
            +Y WV +K+  ER R Y   YC   + +   L  H
Sbjct: 2381 EYVWVHNKMVHERSRPYRCEYCGWHLASKSNLTLH 2415


>SB_15835| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 535

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = -2

Query: 359 LVSNFQRAISIVIPTLTLSL*FVQYPSIFE-GSFTHSWASFSNFSMVRLSIPPHL*IK 189
           L +N Q    +++ TLT +      P++   GS+T+SW S S F ++ LS   HL +K
Sbjct: 188 LENNSQEMAEVILSTLTGADITSLKPTLQAFGSYTNSWMSQSEF-VLHLSPENHLLLK 244


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,029,218
Number of Sequences: 59808
Number of extensions: 467529
Number of successful extensions: 1450
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1331
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1446
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1974037988
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -