SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)             29   2.7  
SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  

>SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1870

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -2

Query: 299  CPAWKLRGRTRRNPPY 252
            CP+W  RG  RRNP Y
Sbjct: 1322 CPSWARRGECRRNPRY 1337


>SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)
          Length = 1026

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = -2

Query: 302 PCPAWKLRGRTRRNPPYSLGQDLPHGVHRENCDGKNCA 189
           P   WK R      P Y LG  +P+ ++   C G  CA
Sbjct: 193 PVEQWKQRLHFVELPVYELGNWIPYALNHWKCFGAGCA 230


>SB_30941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 330

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = -2

Query: 302 PCPAWKLRGRTRRNPPYSLGQDLPHGVHRENCDGKNCA 189
           P   WK R      P Y LG  +P+ ++   C G  CA
Sbjct: 193 PVEQWKQRLHFVELPVYELGNWIPYALNHWKCFGAGCA 230


>SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = +1

Query: 196 FFPSQFSRWTPWGRSW 243
           +FPS F+ W+PW  +W
Sbjct: 3   WFPSSFNSWSPWTWNW 18


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,851,422
Number of Sequences: 59808
Number of extensions: 405833
Number of successful extensions: 1073
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1073
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1817559367
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -