SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33)                     31   0.64 
SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   1.1  
SB_15780| Best HMM Match : Collagen (HMM E-Value=6e-06)                30   1.5  
SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)                     29   2.6  
SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_49922| Best HMM Match : PAN (HMM E-Value=2.1)                       28   6.0  
SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.0  
SB_33053| Best HMM Match : DDE (HMM E-Value=2.1e-08)                   28   6.0  
SB_29793| Best HMM Match : Trigger_N (HMM E-Value=3.3)                 28   6.0  
SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.9  
SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.9  

>SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33)
          Length = 693

 Score = 31.1 bits (67), Expect = 0.64
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 1/85 (1%)
 Frame = +3

Query: 309 GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTPQN 488
           G++       +SYPG  PA  A  G   P    G  +YP   P Q    T+  +P  P  
Sbjct: 34  GFNPPPSSVPVSYPGPPPAMYAVPGMPMPPAYPGMPTYP-PQPMQFLPGTLPGMPPPPMF 92

Query: 489 ASILS-EKQWWLVMKVTMVVPLGDQ 560
           A +++ +   +  M V+   PL  Q
Sbjct: 93  AQMMAPQAMTFQPMPVSATAPLVTQ 117


>SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 610

 Score = 30.3 bits (65), Expect = 1.1
 Identities = 21/76 (27%), Positives = 32/76 (42%)
 Frame = +3

Query: 309 GYSLGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTPQN 488
           G ++   PA  + P +   PT P G   P G     + P   PT     T+   PT P  
Sbjct: 466 GPTVPSGPAVPTGPTVPSGPTVPSGPTVPSG----PTVP-SGPTVPSGPTVPSGPTVPSG 520

Query: 489 ASILSEKQWWLVMKVT 536
            ++ S+    +VM +T
Sbjct: 521 PTVPSDSTVLIVMMIT 536


>SB_15780| Best HMM Match : Collagen (HMM E-Value=6e-06)
          Length = 88

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%)
 Frame = +3

Query: 345 YPGIT--PAPTAPRGHVTPHGAFGYQSYP 425
           YPGI   P P   RG + P G  GYQ  P
Sbjct: 2   YPGIEGPPGPKGDRGPIGPRGPQGYQGAP 30


>SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)
          Length = 231

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 1/62 (1%)
 Frame = +3

Query: 297 SFQPGYSLGQQPAAMSYPGITPAPT-APRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVP 473
           S+ P  S    P+       TP P+  P    T      Y   P  TPT SY  T  + P
Sbjct: 7   SYTPTTSYTSTPSYTPTTSYTPTPSYTPTTSYTC--TTSYTPTPSYTPTPSYTPTTSYTP 64

Query: 474 TT 479
           TT
Sbjct: 65  TT 66



 Score = 28.7 bits (61), Expect = 3.4
 Identities = 20/62 (32%), Positives = 26/62 (41%), Gaps = 1/62 (1%)
 Frame = +3

Query: 297 SFQPGYSLGQQPAAMSYPGITPAPT-APRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVP 473
           S+ P  S    P+  S    TP  +       TP  +  Y   P  TPT SY +T  + P
Sbjct: 79  SYTPTTSYTPTPSYTSTTSYTPTTSYTSTTSYTPTPS--YTPTPSYTPTPSYTSTTSYTP 136

Query: 474 TT 479
           TT
Sbjct: 137 TT 138


>SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 611

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVT-PTQSYDTTIEWVPTTPQ 485
           PAA + PG    P +   +   H +  YQS  +   P  +Y ++ +W+P  PQ
Sbjct: 473 PAANTAPGYVLPPVSTLTN-KGHDSTQYQSAQFAQIPPGAYPSSDQWIPAYPQ 524


>SB_49922| Best HMM Match : PAN (HMM E-Value=2.1)
          Length = 219

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = -1

Query: 437 WCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSETIP 309
           W H  +    +C   CH A RC   W  S V   C ++S   P
Sbjct: 165 WFHENVTSSKECAWLCHQATRC-MAW--SLVEDRCVMMSNMPP 204


>SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1680

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%)
 Frame = +3

Query: 306 PGYSLGQQPAAMSYPGITPAPT-APRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           P  S   QP     P  TPAPT A     TP         P   PTQ+        PT  
Sbjct: 708 PTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQA 767

Query: 483 Q 485
           Q
Sbjct: 768 Q 768


>SB_33053| Best HMM Match : DDE (HMM E-Value=2.1e-08)
          Length = 410

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 9/43 (20%), Positives = 23/43 (53%)
 Frame = +2

Query: 140 RNRKCLDIHTETQIIPHPKDQFTHRSTILQMLHLLASLSTTKL 268
           RNR C+D++ + +++ + KD   H   ++   + +     +K+
Sbjct: 4   RNRTCIDLNRKIELLNYAKDNHMHGVRVIAAKYGIGKTQVSKI 46


>SB_29793| Best HMM Match : Trigger_N (HMM E-Value=3.3)
          Length = 533

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 16/55 (29%), Positives = 23/55 (41%)
 Frame = +3

Query: 330 PAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVPTTPQNAS 494
           P+     G  PAP++P+G V+       Q  P        + T+ WV   P  AS
Sbjct: 124 PSKAHAEGEAPAPSSPQGEVS--DKLDPQRTPRTPLGLKAERTVHWVTLNPSTAS 176


>SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 1/43 (2%)
 Frame = +3

Query: 357 TPAPTAPRGHV-TPHGAFGYQSYPYVTPTQSYDTTIEWVPTTP 482
           TP PT P     TP  +   +  P  TPT +  T     PTTP
Sbjct: 73  TPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTP 115


>SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1577

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 11/34 (32%), Positives = 16/34 (47%)
 Frame = +2

Query: 332 CSNVLPRNHASTNCTSRPCDTTWCIWLSKLSLCD 433
           C   L +NH S  C S+  +   C     LS+C+
Sbjct: 358 CFRCLRKNHRSYECKSKDSNCKGCAGAHHLSICE 391


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,570,441
Number of Sequences: 59808
Number of extensions: 396883
Number of successful extensions: 1285
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1134
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1266
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1312894764
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -