SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20022
         (392 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0)             91   3e-19
SB_4640| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   1.8  
SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)            28   2.3  
SB_41673| Best HMM Match : Glyco_hydro_38 (HMM E-Value=2.3e-24)        28   3.1  
SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   7.2  
SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29)                    27   7.2  
SB_53527| Best HMM Match : zf-C3HC4 (HMM E-Value=3.3e-12)              26   9.5  
SB_30493| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.)               26   9.5  

>SB_18396| Best HMM Match : Ribosomal_L35Ae (HMM E-Value=0)
          Length = 115

 Score = 91.1 bits (216), Expect = 3e-19
 Identities = 46/104 (44%), Positives = 62/104 (59%)
 Frame = +2

Query: 8   RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 187
           RLY K +  G+KRGLRNQH NT+L+K+EG  +R +  FY GK   +VYRAK +T   G  
Sbjct: 6   RLYTKGIVLGFKRGLRNQHPNTSLVKIEGVDERKNTEFYLGKRLAFVYRAKNKTVAKGDK 65

Query: 188 RGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVM 319
           +  K +     G+          VRAKF+ NLP +AMG  +RV+
Sbjct: 66  KATKLRV--IWGKVTRAHGNSGVVRAKFRHNLPPKAMGATVRVI 107


>SB_4640| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 3/70 (4%)
 Frame = +2

Query: 32  TGYKRGLRN---QHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGPRGKKN 202
           T ++R +RN   +H NTA    E  K R +    A    +   +  KR  I  GP G K 
Sbjct: 12  TQFERSIRNPVGKHWNTANTVKELTKPRVEIQMGAIIEPITAPKQFKRRAIMDGPLGVKK 71

Query: 203 QAACYLGQGD 232
           + A   G GD
Sbjct: 72  RGAVKGGDGD 81


>SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)
          Length = 331

 Score = 28.3 bits (60), Expect = 2.3
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
 Frame = -2

Query: 211 RSLVFFATGTSGNW-----CPLLSSVHIDAMLASIKDCIITVFCSFNLEESGVLV 62
           +++VFF+T    N+        L +VHI A+   +K     +F SF   ESG+LV
Sbjct: 91  KNMVFFSTCACVNYFSKALTKFLPNVHIMALHGKMKSNRHKIFDSFRKLESGILV 145


>SB_41673| Best HMM Match : Glyco_hydro_38 (HMM E-Value=2.3e-24)
          Length = 687

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = -2

Query: 316 HSYSVSHSLGREVRLELGSDTPELPCGRVTLP 221
           +SY V H+ G + ++    D   LP GRVT P
Sbjct: 91  YSYDVPHTCGPDPKICCQFDFRRLPGGRVTCP 122


>SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1155

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = +2

Query: 143 YVYRAKKRTPIPGGPRGKKNQAACYLGQGDPPTW 244
           +++  +   P  GG RGK  + +  L  GD  TW
Sbjct: 188 HLHVVRTHMPYGGGKRGKSKKNSSTLDTGDLETW 221


>SB_292| Best HMM Match : HEAT (HMM E-Value=4.6e-29)
          Length = 1239

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -2

Query: 187 GTSGNWCPLLSS-VHIDAMLASIKDCIITVFCSFN 86
           G SG    L SS V  D  L+ IKDC+  +FC  N
Sbjct: 733 GISGLLAFLKSSRVMSDVELSKIKDCLTRLFCDPN 767


>SB_53527| Best HMM Match : zf-C3HC4 (HMM E-Value=3.3e-12)
          Length = 1290

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = +2

Query: 170  PIPGGPRGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPA 289
            PIP G +GK   +  + GQ  P  W    V A  + ++ A
Sbjct: 1114 PIPTGTKGKFIPSTGHKGQVHPIHWHKGHVTASLEEDMDA 1153


>SB_30493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 241

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 13/42 (30%), Positives = 20/42 (47%)
 Frame = +2

Query: 137 CVYVYRAKKRTPIPGGPRGKKNQAACYLGQGDPPTWQLWRVR 262
           C+ VYR K     P G +G++      L +G P  W +  V+
Sbjct: 25  CITVYRRKSTHENPLGIKGQEGNKDGRLSRGLPRKWPIAGVK 66


>SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 598

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 16/53 (30%), Positives = 22/53 (41%)
 Frame = +2

Query: 86  VEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGPRGKKNQAACYLGQGDPPTW 244
           VE     N+     G   ++V R+    P   G RGK  + +  L  GD  TW
Sbjct: 216 VETVVQLNEQFVLQGNFHLHVVRS--HMPFGAGKRGKSKKNSSTLDTGDLETW 266


>SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1218

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 11/41 (26%), Positives = 21/41 (51%)
 Frame = -2

Query: 175 NWCPLLSSVHIDAMLASIKDCIITVFCSFNLEESGVLVLVA 53
           +WCP+  +V     +   +D +I+   S   ++SG  + VA
Sbjct: 833 SWCPVTQNVKEHLTVRFQEDVVISAIASQGADQSGTSMYVA 873


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,774,910
Number of Sequences: 59808
Number of extensions: 276397
Number of successful extensions: 687
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 605
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 685
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 678472135
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -