SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20021
         (476 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0)              160   6e-40
SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   3.4  
SB_32447| Best HMM Match : PHD (HMM E-Value=0.017)                     28   3.4  
SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08)                   28   4.5  
SB_41923| Best HMM Match : Lentiviral_Tat (HMM E-Value=3.8)            27   6.0  
SB_34869| Best HMM Match : Phage_integrase (HMM E-Value=0.087)         27   7.9  
SB_15815| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.9  
SB_9773| Best HMM Match : TPR_2 (HMM E-Value=3.2e-06)                  27   7.9  

>SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0)
          Length = 260

 Score =  160 bits (388), Expect = 6e-40
 Identities = 85/136 (62%), Positives = 99/136 (72%), Gaps = 2/136 (1%)
 Frame = +1

Query: 70  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGNSLYFPRLGIQCGLLVSVVMKRLL 249
           N M+ L IRKL LNICVGESGDRLTRAAKVLEQLTG    F +             +++ 
Sbjct: 2   NPMKELRIRKLVLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIS 61

Query: 250 SMYSPRA-KAEEIL-RXFKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 423
              + R  KAEEIL +  KV+EYEL +  FSATGNFGFGIQEHIDLGIKYDPSIGIYG+D
Sbjct: 62  VHCTVRGPKAEEILEKGLKVKEYELVKGCFSATGNFGFGIQEHIDLGIKYDPSIGIYGMD 121

Query: 424 FYVVLCRPGFNVAHRR 471
           F+VVL RPGFN++ R+
Sbjct: 122 FFVVLGRPGFNISKRK 137


>SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 475

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = -3

Query: 234 YDGYQKTALYT*PWKIQAVSCELLQHLGGTSQPVTGFTNTDVQAKLSDMKI 82
           Y  YQ + L T P +I   S  LL H   T+ P      + +Q  LSD ++
Sbjct: 17  YQTYQLSQLITKPTRITKSSKSLLDHYVTTNSPEKIVKTSVIQTGLSDHRM 67


>SB_32447| Best HMM Match : PHD (HMM E-Value=0.017)
          Length = 443

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%)
 Frame = +2

Query: 155 RCWSNSQE--TACIFQG*VYSAVFWYPS**KDCCPCTVRGLKQKRSLXGLKSENMNCGVT 328
           RC    +E  T+ +    V SA  W       CC CTVRG   KR+  G +  ++ C +T
Sbjct: 143 RCSQEDEEQVTSTVRYHVVESAKVWNALPLDSCCLCTVRGGALKRTQEG-EWVHIACAIT 201


>SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08)
          Length = 551

 Score = 27.9 bits (59), Expect = 4.5
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 319 RRDNFSATGNFGFGIQEHIDLGIKYD 396
           ++ ++SATG+F   ++EHI  G + D
Sbjct: 306 KKSHYSATGSFDGSVEEHISEGAQED 331


>SB_41923| Best HMM Match : Lentiviral_Tat (HMM E-Value=3.8)
          Length = 450

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 14/51 (27%), Positives = 29/51 (56%)
 Frame = +1

Query: 172 TGNSLYFPRLGIQCGLLVSVVMKRLLSMYSPRAKAEEILRXFKVREYELRR 324
           T  +LYF       GL+ S++ +R+ +M + R   +E L+  ++  ++L+R
Sbjct: 313 TLGNLYFDNFFSSVGLMASLLERRIYAMATTRQNRKEFLK--EMNTFKLKR 361


>SB_34869| Best HMM Match : Phage_integrase (HMM E-Value=0.087)
          Length = 897

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = -1

Query: 260 LYMDSNLFITTDTKRP-HCIPSLGKYRLFPVSCSNTLAARVSL 135
           L+M+ NL +TT  KRP   I  +G +  FP   S   A +V +
Sbjct: 194 LFMNGNLVLTTPNKRPRRAIEDIGAW--FPSEKSGFTAVQVRI 234


>SB_15815| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 807

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 260 VRGLKQKRSLXGLKSENMNCGVTTSPPRVILASVFKNTLT 379
           V+GL+++    G K E  N     +  R+ LA +F N +T
Sbjct: 115 VKGLQERGKFQGWKCEFRNNSAFLNSFRIKLAKIFNNEIT 154


>SB_9773| Best HMM Match : TPR_2 (HMM E-Value=3.2e-06)
          Length = 553

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 4/63 (6%)
 Frame = +3

Query: 87  SYQKALLEHLCW*IR*QADSCRQGVGATHRKQPVFSKARYTVR----SFGIRRNEKIAVH 254
           +Y + LL  LC+      ++CRQG   T   +P  S    TV+    S G    E++  +
Sbjct: 397 TYWRKLLTLLCYRDNHSVNTCRQGWKTTSSLEPTTSATTSTVQVDAISIGDDMKEEVDEN 456

Query: 255 VQS 263
           V+S
Sbjct: 457 VRS 459


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,558,138
Number of Sequences: 59808
Number of extensions: 303886
Number of successful extensions: 799
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 797
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 989515521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -