SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_30955| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.099
SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     29   2.8  
SB_30478| Best HMM Match : DUF723 (HMM E-Value=4.8)                    29   3.7  
SB_50693| Best HMM Match : C2 (HMM E-Value=0)                          28   4.9  
SB_8156| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.5  
SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)                   27   8.6  
SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)                   27   8.6  
SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.6  
SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.6  
SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)                    27   8.6  

>SB_30955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 971

 Score = 33.9 bits (74), Expect = 0.099
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +1

Query: 199 WRD*LCRPHPWLPAADPR*NSRCSKVVCSMHCSCDSSVCLTLLLIVSSVSMG 354
           W D +C+  PWL   DP   S+    +  MH    S  C   L ++SS + G
Sbjct: 342 WYDVVCQYWPWLRMHDPDTASKMKPALSVMHAKAHSWNCQATLEVISSDNNG 393


>SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 927

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/38 (39%), Positives = 18/38 (47%)
 Frame = -1

Query: 542 SAFFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSYV 429
           S FF   L F A R   M T  +   F R S+SW  Y+
Sbjct: 312 SGFFSNTLHFLATRISEMATYGKIDEFDRDSDSWEQYI 349


>SB_30478| Best HMM Match : DUF723 (HMM E-Value=4.8)
          Length = 705

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = -2

Query: 352 PLRQMILLRGASNIQMSRTNNASNRPLLSSVNFILGQQLEARDEAG-KVNHATYYMGETL 176
           P   + +  G S+++ +  N  S+   L+    ++   L  +D A    NH+TY   ET+
Sbjct: 242 PKLHLKIRTGISSVKTAEVNPKSSLLRLTRAGGVVDDNLPGKDWATFSSNHSTYEPVETI 301

Query: 175 RKFLFRLQL 149
            + +F+ Q+
Sbjct: 302 SREIFKPQI 310


>SB_50693| Best HMM Match : C2 (HMM E-Value=0)
          Length = 1049

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = -2

Query: 424 KLESRINEKLALAPLWMESLFISCP 350
           K  SR+++K  L P+WMES+ +S P
Sbjct: 641 KFRSRVHQK-TLNPVWMESVALSLP 664


>SB_8156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 17/55 (30%), Positives = 22/55 (40%)
 Frame = +2

Query: 392 CKFLVDSTFKFAERMNSMNLTDAEIGLFWXXXXXXRIGLLRNIELVERMHSRLRR 556
           C  L   TF+     +   L+ +E+   W      R G L  IELVE   S   R
Sbjct: 36  CGNLTRETFRKLFERHEFKLSGSEVDSLWKKLPIERDGTLNFIELVETCFSAAGR 90


>SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1671

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = -1

Query: 536 FFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSYV 429
           FF   L F A R   M T  +   F R S+SW  Y+
Sbjct: 161 FFSNTLHFLATRISEMATYGKIDEFDRDSDSWEQYI 196


>SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)
          Length = 1556

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = -1

Query: 536 FFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSYV 429
           FF   L F A R   M T  +   F R S+SW  Y+
Sbjct: 345 FFSNTLHFLATRISEMATYGKIDEFDRDSDSWEQYI 380


>SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1258

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 13/41 (31%), Positives = 21/41 (51%)
 Frame = +3

Query: 312 MFDAPLNSIICLNGQLMKRDSIQSGANASFSLILLSSLRNV 434
           +F  PL ++ CL   L K DS+      +F L L   L+++
Sbjct: 551 IFQVPLQAVCCLKDYLEKNDSVSEREVWNFLLDLTLGLKHL 591


>SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1555

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
 Frame = -3

Query: 552  LSRECILSTSSMFRSRPIRSDEDYSQK-SPISASVKFMEFIRSANLKVESTRNLHWHRSG 376
            + +EC++  S +     I+  EDYS+  + I A V F   +RSA + +  +R++   +  
Sbjct: 1481 MGKECLMFHSRLAELIAIKKGEDYSRTIAWIRARVSF-ALLRSALICLRGSRSV--RKVS 1537

Query: 375  WSLSSS 358
            W L +S
Sbjct: 1538 WDLRNS 1543


>SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1520

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 14/36 (38%), Positives = 17/36 (47%)
 Frame = -1

Query: 536 FFPLALCFAAGRSGVMRTIARKALFPRPSNSWNSYV 429
           FF   L F A R   M T  +   F R S+SW  Y+
Sbjct: 264 FFSNTLHFLATRISEMATYGKIDEFDRDSDSWEQYI 299


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,011,522
Number of Sequences: 59808
Number of extensions: 354722
Number of successful extensions: 1086
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 991
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1086
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1422302661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -