SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24)        81   9e-16
SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   9e-16
SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27)        33   0.17 
SB_22730| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05)           28   6.4  
SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.5  
SB_21511| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.74)           28   8.5  

>SB_55500| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=2.8e-24)
          Length = 172

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 38/66 (57%), Positives = 47/66 (71%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           H+T LVE KKAQL      + P+   ++LPALCRKM VPYCIVKGK+RLG +VH+K  T 
Sbjct: 51  HITSLVENKKAQLVVIAHDVDPIEIVVWLPALCRKMQVPYCIVKGKARLGKVVHKKNATA 110

Query: 686 LALTNV 703
           L +T V
Sbjct: 111 LCITGV 116


>SB_16903| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 263

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 38/66 (57%), Positives = 47/66 (71%)
 Frame = +2

Query: 506 HVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTC 685
           H+T LVE KKAQL      + P+   ++LPALCRKM VPYCIVKGK+RLG +VH+K  T 
Sbjct: 142 HITSLVENKKAQLVVIAHDVDPIEIVVWLPALCRKMQVPYCIVKGKARLGKVVHKKNATA 201

Query: 686 LALTNV 703
           L +T V
Sbjct: 202 LCITGV 207



 Score = 75.4 bits (177), Expect = 4e-14
 Identities = 32/56 (57%), Positives = 44/56 (78%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPET 401
           L +  + P+Y+++QRQK++L +RLKVPP INQFTQ LD+ +   LFK+L KYRPET
Sbjct: 51  LSRFVRWPRYVKLQRQKSLLYQRLKVPPAINQFTQALDRQSTVQLFKLLHKYRPET 106



 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 23/30 (76%), Positives = 24/30 (80%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCP 258
           NPL EKRP+NF IG  IQP RDLSRFVR P
Sbjct: 29  NPLIEKRPRNFGIGGDIQPKRDLSRFVRWP 58


>SB_38307| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=1.6e-27)
          Length = 187

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +2

Query: 569 PLSWFLFLPALCRKMGVPYCIVKGKSRLGAL--VHRKTCTCLALTN 700
           PL   L LP LC    VPY  V+ K+ LG    V R    C    N
Sbjct: 121 PLEILLHLPLLCEDKNVPYVFVRSKAALGRATGVTRPVIACAVTVN 166


>SB_22730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 247

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLM---MLIPLSWFLFLPALCRKMGVPYCIV 634
           V +++ K +A  WS +    +L P S   F   LC ++G P+C V
Sbjct: 72  VGRILAKARATAWSGIQTWDVLSPSSCTSFASPLCTRVGWPHCHV 116


>SB_48160| Best HMM Match : Cytochrom_C (HMM E-Value=1.8e-05)
          Length = 212

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -2

Query: 479 PLWWRLIFLGNLSFSSFPQPLFPG 408
           P WW ++F+G + FS     L+PG
Sbjct: 56  PKWWFMLFIGTIVFSIGYLVLYPG 79


>SB_35585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 655

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +2

Query: 290 TSASSESAPSDQPIYPDTG 346
           T+ASSE+APS  P  PD G
Sbjct: 43  TAASSEAAPSSAPSMPDYG 61


>SB_21511| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.74)
          Length = 437

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -1

Query: 693 RAKHVHVLRCTSAPRRDLPLT 631
           R +H H+ RCTSAP    P T
Sbjct: 74  RKRHFHLRRCTSAPEPSSPNT 94


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,963,459
Number of Sequences: 59808
Number of extensions: 412560
Number of successful extensions: 1250
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1247
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1853669818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -