SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   9e-16
SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   4e-08
SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014)             53   3e-07
SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.005
SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0)                   37   0.019
SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0)                    36   0.033
SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42)         33   0.18 
SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)             32   0.41 
SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20)             32   0.54 
SB_5749| Best HMM Match : Gpi1 (HMM E-Value=7.8)                       32   0.54 
SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0)                   31   0.71 
SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061)                31   0.71 
SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0)                   31   0.94 
SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0)                   31   0.94 
SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)           31   1.2  
SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21)                 30   2.2  
SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)                  30   2.2  
SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18)                  29   2.9  
SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0)                      29   2.9  
SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44)         29   3.8  
SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05)             29   3.8  
SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0)                   29   5.0  
SB_36048| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)                   28   6.6  
SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17)                   28   6.6  
SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.8  

>SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 304

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 49/90 (54%), Positives = 53/90 (58%), Gaps = 3/90 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY-FXXXXXXXXXXX 424
           G LSFWRGN AN IRYFPTQALNFAFKD+ K +F     KKT      F           
Sbjct: 68  GFLSFWRGNLANCIRYFPTQALNFAFKDQVKALF---KPKKTDSNAIKFSKNIASGGAAG 124

Query: 425 XTSLCFVYPLDFARTRLAAD--VGKGDGQR 508
             SL FVY LD+ RTRLA D  VGK  G+R
Sbjct: 125 AMSLFFVYSLDYCRTRLANDAKVGKKGGER 154



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F ++F   G +A +SKTA APIERVKLL+Q Q  + K    D  YKG++D   R  + +G
Sbjct: 9   FVENFGLSGAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLDHPYKGVIDCTSRTYRSEG 68



 Score = 32.3 bits (70), Expect = 0.41
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+G+ +   K   SDGL+GLYRGF
Sbjct: 156 FNGMIDVYKKTIASDGLVGLYRGF 179



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGMLPDPKNTPIVISW 692
           II+YR  YFG YDT + +L   ++  +VIS+
Sbjct: 186 IIVYRGFYFGLYDTLKPILLG-EDAGVVISF 215


>SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 262

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 26/58 (44%), Positives = 42/58 (72%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           K  LAGGI+ AVS+T+V+P+ERVK+LLQ+Q        + ++KG++   ++I KE+G+
Sbjct: 36  KHLLAGGIAGAVSRTSVSPLERVKILLQIQ------VKNPKFKGVLPTLIQIGKEEGI 87



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +2

Query: 179 QADRRRPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 343
           Q   + P  +G    L    +  G L +++GN  NVIR FP  A+ FA  ++YK+
Sbjct: 63  QIQVKNPKFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYKK 117


>SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014)
          Length = 76

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +3

Query: 48  MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDA 224
           MS     + F ++F   G +A +SKTA APIERVKLL+Q Q  + K       YKG+VD 
Sbjct: 1   MSGKKQNLHFVENFALSGAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLSSPYKGVVDC 60

Query: 225 FVRIPKEQGL 254
            +R  + +G+
Sbjct: 61  TMRTYRAEGI 70


>SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 453

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 23/53 (43%), Positives = 32/53 (60%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           GG  A VS+TA AP++R+K+LLQVQ      A+     GIV  F  + +E G+
Sbjct: 143 GGALAGVSRTATAPLDRLKVLLQVQ------ASSTNRFGIVSGFKMMLREGGI 189



 Score = 35.5 bits (78), Expect = 0.044
 Identities = 30/92 (32%), Positives = 40/92 (43%)
 Frame = +2

Query: 203 LQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFW 382
           + G++  LR      G  S WRGN ANVI+  P   + F   +K K+  L G D K    
Sbjct: 177 VSGFKMMLRE----GGIKSLWRGNGANVIKIAPESGIKFFAYEKAKK--LVGSDTKALGV 230

Query: 383 RYFXXXXXXXXXXXXTSLCFVYPLDFARTRLA 478
                          TS   +YPL+  +TRLA
Sbjct: 231 TDRLLAGSMAGVASQTS---IYPLEVLKTRLA 259


>SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 3/72 (4%)
 Frame = +3

Query: 45  KMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ---HVSKQIAADQRYKGI 215
           K+ N   P    +    G +S  +SK  + P + +K  +QVQ      +     Q+Y G+
Sbjct: 19  KVHNPYKPADVIESLTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGV 78

Query: 216 VDAFVRIPKEQG 251
            D F  I KE+G
Sbjct: 79  KDCFRTILKEEG 90


>SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 375

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           LAG  S  ++   V P E +K  L VQHV+K   ++  YKG+  A   I +E+G+
Sbjct: 157 LAGTSSTLIAMVTVYPCEVIKTRLTVQHVNK---SNAHYKGMRHALKTILREEGI 208



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 17/62 (27%), Positives = 33/62 (53%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           + + + FL GG SA ++++  +P+E VK+L QV          +   G++  F  + K +
Sbjct: 56  ITWFQSFLCGGTSAVLARSLTSPLEVVKVLAQV-------GTQEAKPGLIRTFASVYKRE 108

Query: 249 GL 254
           G+
Sbjct: 109 GI 110



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFA 322
           G  +FW+GN  + IR FP  A+ +A
Sbjct: 109 GIKAFWKGNGVSCIRLFPYSAVQYA 133


>SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 276

 Score = 35.9 bits (79), Expect = 0.033
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 9/73 (12%)
 Frame = +3

Query: 63  DPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAA---------DQRYKGI 215
           DP    K F + GI+A++++ A  PI+  K+ LQ+Q  S  +A+         D  Y+G+
Sbjct: 11  DPSILVK-FCSAGIAASIAEAATIPIDTAKVRLQIQGESAVMASIAQGVRTTHDAHYRGM 69

Query: 216 VDAFVRIPKEQGL 254
           +   V + K +G+
Sbjct: 70  LGTMVTLFKTEGM 82


>SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42)
          Length = 247

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +3

Query: 132 APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           AP ERVK LLQVQ   K+     RY+G+ D  +++ +  GL
Sbjct: 179 APTERVKCLLQVQ---KESGTKARYQGLGDCLLQVYRTGGL 216



 Score = 31.9 bits (69), Expect = 0.54
 Identities = 9/25 (36%), Positives = 20/25 (80%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + GLG+C+ +++++ GL G+++G G
Sbjct: 200 YQGLGDCLLQVYRTGGLRGVFKGLG 224


>SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23)
          Length = 1026

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +3

Query: 102  ISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
            I  A   TAV PI+ VK  +Q Q     + A++ YK  +D F ++ + +G
Sbjct: 922  IKKATGATAVYPIDLVKTRMQNQRAV--LEAEKVYKNSIDCFFKVVRNEG 969


>SB_39188| Best HMM Match : Ion_trans (HMM E-Value=4.9e-20)
          Length = 551

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +3

Query: 531 HQQDLQVRRSDWSVQRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISWASLR 704
           H +D  +R +  +V+ FR    S II      G+Y  A   + D K   I  SWA+L+
Sbjct: 147 HARDNDLRSNTTTVRAFRYSAMSFIIIHLFACGWYYLACDNMADGKGKCITKSWANLK 204


>SB_5749| Best HMM Match : Gpi1 (HMM E-Value=7.8)
          Length = 226

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = +3

Query: 531 HQQDLQVRRSDWSVQRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPIVISWASLR 704
           H +D  +R +  +V+ FR    S II      G+Y  A   + D K   I  SWA+L+
Sbjct: 167 HARDNDLRSNTTTVRAFRYSAMSFIIIHLFACGWYYLACDNMADGKGKCITKSWANLK 224


>SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 328

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 218
           S K+    DP    +   AG I+   +   + P++RVK +LQ++    +      Y G V
Sbjct: 126 SYKLPVSKDP-ELLRSLAAGMIAGVATSFVLTPLDRVKCILQIE----KAFGGSSYGGPV 180

Query: 219 DAFVRIPKEQGL 254
           D   RI +E G+
Sbjct: 181 DCLRRIYREAGV 192


>SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061)
          Length = 114

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +3

Query: 99  GISAAVSKTAVAPIERVKLLLQVQH 173
           G+S   +KT  AP+ER+K+L Q Q+
Sbjct: 63  GLSTCCAKTTTAPLERLKILFQAQN 87


>SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 264

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 14/56 (25%), Positives = 31/56 (55%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F+ GG++ AVS+T   P++ V+  +Q   ++  +    +Y   ++  V + K+ G+
Sbjct: 176 FVCGGVAGAVSQTIAYPLDVVRRRMQ---LAGAVPDGHKYNTCINTLVNVYKDDGI 228


>SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 274

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           SNL      A   +AGG +  VS  +  P + +K  +Q      +     RYKG++D  +
Sbjct: 124 SNLFGSRGVATYLMAGGFAGVVSWASTFPFDVIKSRIQADGNLGKF----RYKGMMDCAL 179

Query: 231 RIPKEQGL 254
           +  KE+G+
Sbjct: 180 QSYKEEGM 187


>SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)
          Length = 773

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 10/25 (40%), Positives = 19/25 (76%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           +SG+G  ++KI++ +GL G ++G G
Sbjct: 591 YSGVGGTLAKIYRDEGLYGYFKGNG 615



 Score = 28.3 bits (60), Expect = 6.6
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 343
           G   +++GN  N++R  P  A+ FA  +++K+
Sbjct: 606 GLYGYFKGNGTNIVRIVPYTAVQFAAYEEFKK 637


>SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21)
          Length = 198

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQ 164
           AGG++   S+T  AP+E++K++ Q
Sbjct: 175 AGGVAGVASRTLTAPLEKMKIIAQ 198


>SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)
          Length = 609

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/50 (30%), Positives = 26/50 (52%)
 Frame = +3

Query: 531 HQQDLQVRRSDWSVQRFRCVRASIIIYRASYFGFYDTARGMLPDPKNTPI 680
           H+    ++RS     +F   +A + +   SY G   TA G+ PDP+ +P+
Sbjct: 524 HKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKSPM 573


>SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = -1

Query: 485 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTAS-SC 363
           +  RD   RS+  +R++ RWL R  R+P    S+ R++S SC
Sbjct: 6   NNNRDN-TRSQVRSRNSNRWLLRQQRQPQRHLSHKRSSSNSC 46


>SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18)
          Length = 765

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 16/53 (30%), Positives = 21/53 (39%)
 Frame = -1

Query: 485 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTASSCQRRRGTPACTCP 327
           HR+   + RSR       R  R+  R         R +SSC+RRR       P
Sbjct: 275 HRKHRSHSRSRSPRSKRSRSPRKRRRSKSRSPRRYRDSSSCRRRRSRSRSRSP 327


>SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVA--PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           LA G+ A VS+  V   P+E +K    V+ +  Q   + +YKG       I K +G F
Sbjct: 140 LASGLGAGVSEAVVVVCPMETIK----VKFIHDQTQPNPKYKGFFSGVRTILKTEGFF 193


>SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0)
          Length = 2411

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/23 (52%), Positives = 13/23 (56%)
 Frame = -1

Query: 395  QRSNARTASSCQRRRGTPACTCP 327
            Q  + R  S CQRRRG   C CP
Sbjct: 934  QLVSCRFYSKCQRRRGGAQCVCP 956


>SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 796

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 263 WRGNFANVIRYFPTQALNFAFKDKYKQV 346
           W G F++VI  F   A+N AF+++YK++
Sbjct: 282 WIGAFSSVINPFIYGAMNPAFREEYKKI 309


>SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44)
          Length = 192

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F A  IS   +  A  P++  K  +Q   +   I     YKG +D   RI + +G+F
Sbjct: 97  FGASMISGLATTVASMPVDIAKTRIQNMRI---IDGKPEYKGTMDVLARIVRNEGVF 150


>SB_41780| Best HMM Match : Mito_carr (HMM E-Value=3.9e-05)
          Length = 383

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +1

Query: 526 NCISKIFKSDGLIGLYRGFG 585
           +C   I++ +G+ G YRGFG
Sbjct: 332 DCFRTIYQQEGIFGFYRGFG 351


>SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0)
          Length = 611

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++G  +C+ K+F S+GL G +RG
Sbjct: 297 YTGSLDCLKKVFHSEGLRGCFRG 319


>SB_36048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 312

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 549 LEDLADAVSETGELRWPSPLPTSAARRVRAKSRGYTK 439
           L+D+  A+S T +   P  +PT A R V  +S G T+
Sbjct: 150 LQDMTLAISSTPQTLSPVSVPTPATRSVLKRSPGKTR 186


>SB_15720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1277

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 476 RDGYVRSRGGTRSTERWLRRHHRRPDY-QRSNARTASSCQR 357
           +DG V +RG TR +    R H RR  +  R + R +S+  R
Sbjct: 591 QDGQVTTRGHTRRSSNTTRSHTRRSSHTTRGHTRRSSNTTR 631


>SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)
          Length = 2049

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -1

Query: 482 RRRDGYVRSRGGTRSTERWLRRHHR-RPDYQRSNARTASSCQRRRGTP 342
           R+ +   R +GG R+T+   ++H R +PD +R+  R       R+GTP
Sbjct: 865 RKVEERARHKGGNRATQEREKKHRRNQPDKRRTQMRIP-----RKGTP 907


>SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17)
          Length = 890

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = +3

Query: 531 HQQDLQVRRSDWSVQRFRCVRASIIIYRASYFGFYDTARGMLPDPK--NTPIVISWASLR 704
           H+    ++RS     +F   +A + +   SY G   TA G+ PDP+    P+     +L 
Sbjct: 334 HKMIAVLKRSREIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKDERPVAFGSKTLS 393

Query: 705 P*HSR 719
           P  +R
Sbjct: 394 PAETR 398


>SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = +2

Query: 236 PQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 346
           P+    L  W G  ++VI  F   A+N  F+D+YK++
Sbjct: 140 PREVYVLYTWLGTLSSVINPFIYGAMNPVFRDEYKKL 176


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,988,684
Number of Sequences: 59808
Number of extensions: 380544
Number of successful extensions: 1441
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 1280
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1431
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -