SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20005
         (763 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4971| Best HMM Match : Ras (HMM E-Value=0)                         125   3e-29
SB_53183| Best HMM Match : Ras (HMM E-Value=0)                        123   1e-28
SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21)                  113   1e-25
SB_50523| Best HMM Match : Ras (HMM E-Value=0)                        112   3e-25
SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08)                   105   4e-23
SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.)             103   2e-22
SB_13045| Best HMM Match : Ras (HMM E-Value=0)                         99   2e-21
SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.)              97   2e-20
SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.)              96   3e-20
SB_28695| Best HMM Match : Ras (HMM E-Value=0)                         95   6e-20
SB_36483| Best HMM Match : Ras (HMM E-Value=0)                         93   2e-19
SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30)                    86   3e-17
SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   6e-17
SB_27557| Best HMM Match : Ras (HMM E-Value=0)                         85   6e-17
SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.)              84   1e-16
SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22)                   83   2e-16
SB_7589| Best HMM Match : Ras (HMM E-Value=0)                          83   2e-16
SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05)                   82   6e-16
SB_44625| Best HMM Match : Ras (HMM E-Value=0)                         81   1e-15
SB_8315| Best HMM Match : Ras (HMM E-Value=0)                          81   1e-15
SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.)               79   5e-15
SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44)                75   5e-14
SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   8e-14
SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.)               75   8e-14
SB_50855| Best HMM Match : Ras (HMM E-Value=0)                         74   1e-13
SB_10811| Best HMM Match : Ras (HMM E-Value=0)                         70   2e-12
SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34)                     68   1e-11
SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_29274| Best HMM Match : Ras (HMM E-Value=2.5e-05)                   64   2e-10
SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30)                   63   2e-10
SB_11841| Best HMM Match : Ras (HMM E-Value=0)                         62   4e-10
SB_1286| Best HMM Match : Ras (HMM E-Value=2e-09)                      62   6e-10
SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   1e-09
SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42)               60   3e-09
SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09)                    58   6e-09
SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40)                 57   2e-08
SB_1277| Best HMM Match : DAO (HMM E-Value=6e-32)                      57   2e-08
SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17)                    53   2e-07
SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11)                     53   2e-07
SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   4e-07
SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35)                     52   5e-07
SB_1071| Best HMM Match : Ras (HMM E-Value=0)                          52   7e-07
SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10)                   51   9e-07
SB_54971| Best HMM Match : Ras (HMM E-Value=0)                         50   2e-06
SB_37276| Best HMM Match : Ras (HMM E-Value=0.00045)                   49   4e-06
SB_11757| Best HMM Match : Ras (HMM E-Value=0)                         49   5e-06
SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31)                   48   8e-06
SB_22751| Best HMM Match : Ras (HMM E-Value=0.0049)                    47   1e-05
SB_6223| Best HMM Match : Ras (HMM E-Value=0)                          46   3e-05
SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13)                   46   4e-05
SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21)                   45   6e-05
SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13)                     45   8e-05
SB_22529| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_47462| Best HMM Match : Ras (HMM E-Value=0)                         44   1e-04
SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   1e-04
SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)                   43   2e-04
SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35)                     43   2e-04
SB_11310| Best HMM Match : Arf (HMM E-Value=0)                         43   3e-04
SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05)                   42   4e-04
SB_37042| Best HMM Match : Arf (HMM E-Value=0)                         42   5e-04
SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13)                   42   7e-04
SB_56255| Best HMM Match : Arf (HMM E-Value=0)                         41   0.001
SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19)                   41   0.001
SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07)                   41   0.001
SB_53421| Best HMM Match : Arf (HMM E-Value=0)                         40   0.003
SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19)                 38   0.009
SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31)                   38   0.009
SB_22530| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.012
SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.012
SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36)                     37   0.021
SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06)                   37   0.021
SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8)                  36   0.036
SB_18358| Best HMM Match : Arf (HMM E-Value=0)                         36   0.036
SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35)                   36   0.047
SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.063
SB_8139| Best HMM Match : Ras (HMM E-Value=0.02)                       35   0.083
SB_31701| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_31439| Best HMM Match : Ras (HMM E-Value=4.7)                       34   0.11 
SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96)                  34   0.11 
SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10)                      33   0.19 
SB_33026| Best HMM Match : Ras (HMM E-Value=3.7e-08)                   33   0.25 
SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.)                33   0.25 
SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.33 
SB_43575| Best HMM Match : Sina (HMM E-Value=0)                        33   0.33 
SB_35222| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.58 
SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.58 
SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_15460| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.4  
SB_15868| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_7780| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.1  
SB_35075| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.5  
SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7)                      29   5.5  
SB_57342| Best HMM Match : Arf (HMM E-Value=0)                         29   5.5  
SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21)                   29   5.5  
SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2)                  28   7.2  
SB_53088| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_47450| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  
SB_34906| Best HMM Match : Cadherin (HMM E-Value=0)                    28   9.5  
SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  
SB_13497| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  

>SB_4971| Best HMM Match : Ras (HMM E-Value=0)
          Length = 209

 Score =  125 bits (302), Expect = 3e-29
 Identities = 56/77 (72%), Positives = 68/77 (88%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M   YD LFKLLLIGDSGVGK+S+L RF++D F+ ++ISTIG+DFKIRT+ +DGK +KLQ
Sbjct: 1   MNSEYDYLFKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQ 60

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERFRT+TTAY
Sbjct: 61  IWDTAGQERFRTLTTAY 77



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 35/84 (41%), Positives = 51/84 (60%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R + GI+L+YDV   ++F ++  W+  + E A   V  +++GNKCDL   RQV     ++
Sbjct: 79  RSAHGIVLIYDVNESETFLHLSQWLEEVSEYACEGVNTILVGNKCDLIDCRQVGYNTAKE 138

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  I F+ETSAKDS NVE  F
Sbjct: 139 FAEKLDISFIETSAKDSTNVESVF 162


>SB_53183| Best HMM Match : Ras (HMM E-Value=0)
          Length = 834

 Score =  123 bits (297), Expect = 1e-28
 Identities = 54/80 (67%), Positives = 70/80 (87%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIE 447
           GIMLVYD+T EK+F+NI  W+RNIEE+A+ DVEKMILGNKCD+D +R VS+ERGEQ+A E
Sbjct: 127 GIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIARE 186

Query: 448 YQIKFVETSAKDSLNVEYAF 507
           + I+F+ETSAK ++N+E AF
Sbjct: 187 HGIRFLETSAKTNINIEQAF 206



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 33/39 (84%), Positives = 36/39 (92%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTI 145
           K+YD LFKLLLIGDSGVGKT ILFRFS+DAFN +FISTI
Sbjct: 4   KSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTI 42


>SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21)
          Length = 115

 Score =  113 bits (273), Expect = 1e-25
 Identities = 48/75 (64%), Positives = 66/75 (88%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           + +D +FKLL+IG+S VGKTS LFR+++D+F  +F+ST+GIDFK++T+  + K+VKLQIW
Sbjct: 16  QNFDYMFKLLIIGNSAVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRNDKRVKLQIW 75

Query: 209 DTAGQERFRTITTAY 253
           DTAGQER+RTITTAY
Sbjct: 76  DTAGQERYRTITTAY 90



 Score = 35.1 bits (77), Expect = 0.063
 Identities = 12/23 (52%), Positives = 21/23 (91%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKN 324
           RG+MG +L+YD+TNE+SF+ +++
Sbjct: 92  RGAMGFILMYDITNEESFQAVQD 114


>SB_50523| Best HMM Match : Ras (HMM E-Value=0)
          Length = 154

 Score =  112 bits (270), Expect = 3e-25
 Identities = 48/84 (57%), Positives = 68/84 (80%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MGIMLVYDVTNEKSF NI  W++ I+++A+ DV++M++GNKCD+  +R +S+ +GEQ
Sbjct: 27  RGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQ 86

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
           LA  Y I F+ETSA  ++NVE +F
Sbjct: 87  LASSYGISFIETSALSNINVEKSF 110



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = +2

Query: 182 GKKVKLQIWDTAGQERFRTITTAY 253
           GKK+KLQIWDTAGQERF TITTAY
Sbjct: 2   GKKIKLQIWDTAGQERFHTITTAY 25


>SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08)
          Length = 492

 Score =  105 bits (252), Expect = 4e-23
 Identities = 52/84 (61%), Positives = 65/84 (77%), Gaps = 3/84 (3%)
 Frame = +1

Query: 220 SREIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD 399
           S+EIP +   I     GIMLVYD+TN+KSFE  +NWIRNIEE+AS DVEKM+LGNKCD++
Sbjct: 73  SKEIPAD--IIYEDDKGIMLVYDITNDKSFEKHQNWIRNIEEHASQDVEKMVLGNKCDME 130

Query: 400 SQRQVSKERGEQ---LAIEYQIKF 462
            +RQVSKERGEQ   L + Y++ F
Sbjct: 131 DRRQVSKERGEQGDLLFLMYKVPF 154


>SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 778

 Score =  103 bits (247), Expect = 2e-22
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 21/98 (21%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFS---------------------EDAFNISFIS 139
           M   YD LFKLLLIGDSGVGK+ +L RF+                     +D +  S+IS
Sbjct: 1   MNPEYDYLFKLLLIGDSGVGKSCLLLRFALSLAQKLLLFRIYSHPTLSQQDDTYTESYIS 60

Query: 140 TIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           TIG+DFKIRTI+LDGK +KLQIWDTAGQERFRTIT++Y
Sbjct: 61  TIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSY 98



 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 38/88 (43%), Positives = 62/88 (70%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S  RG+ GI++VYDVT+++SF N+K W++ I+  A  +V K+++GNKCDL +++ V   
Sbjct: 96  SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFT 155

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
             ++ A    + F+ETSAK++ NVE AF
Sbjct: 156 TAKEYAESLGVPFLETSAKNATNVEQAF 183


>SB_13045| Best HMM Match : Ras (HMM E-Value=0)
          Length = 629

 Score =   99 bits (238), Expect = 2e-21
 Identities = 43/73 (58%), Positives = 60/73 (82%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD L+K++LIGDSGVGK+S+L RF+ + F+I   STIG++F  R+I ++GK +K Q+WDT
Sbjct: 9   YDYLYKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDT 68

Query: 215 AGQERFRTITTAY 253
           AGQER+R IT+AY
Sbjct: 69  AGQERYRAITSAY 81



 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 28/77 (36%), Positives = 52/77 (67%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+T +K+F++++ W+  + E+A   +  M++GNKCDL   R V+ +  ++
Sbjct: 83  RGAVGAVLVYDLTKQKTFQDVERWLLEVREHADPTIVVMLVGNKCDLKHLRAVASDDAKK 142

Query: 436 LAIEYQIKFVETSAKDS 486
              E+ + F+E SA D+
Sbjct: 143 YGDEHGLAFIEASALDA 159


>SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 919

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 39/68 (57%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+L++G+SGVGK+S+L RF++D F+    +TIG+DFK++T+ ++G K KL IWDTAGQER
Sbjct: 10  KILIVGESGVGKSSLLLRFTDDTFDPDIGATIGVDFKVKTLTVEGNKAKLAIWDTAGQER 69

Query: 230 FRTITTAY 253
           FRT+T +Y
Sbjct: 70  FRTLTPSY 77



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 23/70 (32%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIE-ENASADVEKMILGNKCDLDSQRQVSKE 423
           S  RG+ G++LVYD  + ++F+ ++ W+  +E  +   D+ KM++GNK D  S    S +
Sbjct: 76  SYYRGAQGVILVYDTNSRETFDKLEEWLNEVEMYSTKKDIVKMLVGNKIDKHS----SSK 131

Query: 424 RGEQLAIEYQ 453
            G++L  +Y+
Sbjct: 132 CGQKLLGDYR 141


>SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 42/73 (57%), Positives = 59/73 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           Y  LFK++L+GD+ VGKT ++ +F++  F  +   TIG+DF I+T+D+DG+KVKLQIWDT
Sbjct: 4   YSYLFKIILVGDANVGKTCLVRQFTKGYFPPNQGPTIGVDFTIKTVDVDGEKVKLQIWDT 63

Query: 215 AGQERFRTITTAY 253
           AGQERFR+IT +Y
Sbjct: 64  AGQERFRSITQSY 76



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 21/49 (42%), Positives = 33/49 (67%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQV 414
           G+++ YD+TN+KSFE++  W+ +     S DV   I+GNK DL + R+V
Sbjct: 82  GVIVTYDITNKKSFESLPQWLDDTNRYTSKDVLIAIVGNKSDLSTNRKV 130


>SB_28695| Best HMM Match : Ras (HMM E-Value=0)
          Length = 1058

 Score = 95.1 bits (226), Expect = 6e-20
 Identities = 41/75 (54%), Positives = 60/75 (80%)
 Frame = +2

Query: 29   KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
            KT + +FK++ IGDSGVGK+S L RF  D +  SF +TIG+DF+I+T++++G+ + +Q+W
Sbjct: 891  KTPERVFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLW 950

Query: 209  DTAGQERFRTITTAY 253
            DTAGQERFR+IT  Y
Sbjct: 951  DTAGQERFRSITKQY 965



 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 3/86 (3%)
 Frame = +1

Query: 256  RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL---DSQRQVSKER 426
            R + GI++ YDVT E SF N+K W+ ++EE A   V KM+LGNK DL   +  R V    
Sbjct: 967  RKADGILIFYDVTAESSFTNLKKWMVSVEEGAEEGVAKMVLGNKTDLAEDEESRVVKTID 1026

Query: 427  GEQLAIEYQIKFVETSAKDSLNVEYA 504
            G+ LA +Y   ++ETSAK   N++ A
Sbjct: 1027 GKNLANQYDALYMETSAKTGNNIQEA 1052


>SB_36483| Best HMM Match : Ras (HMM E-Value=0)
          Length = 213

 Score = 93.1 bits (221), Expect = 2e-19
 Identities = 38/72 (52%), Positives = 56/72 (77%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D +FK+L++GD  VGK+S++ RF +D FN    +TIG+DF I   DLDGKKVKLQ+WDTA
Sbjct: 8   DYVFKVLVLGDCNVGKSSLIRRFHDDEFNAQLCTTIGVDFFIHDFDLDGKKVKLQLWDTA 67

Query: 218 GQERFRTITTAY 253
           G+E++R ++ ++
Sbjct: 68  GEEKYRALSRSF 79



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/90 (36%), Positives = 60/90 (66%), Gaps = 1/90 (1%)
 Frame = +1

Query: 241 NNSILRGSMGIMLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDLDSQRQVS 417
           + S  RG+ G +LV+DV+ ++SF++I++ W+    + + +D   +++GNKCD    ++VS
Sbjct: 76  SRSFFRGADGALLVFDVSVKESFDSIRDYWLHEFHKVSGSDTITILVGNKCD-KKDKKVS 134

Query: 418 KERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +E  + L+  Y + ++ETSAKD+ NV  AF
Sbjct: 135 EEDIQNLSSCYNLSWLETSAKDNTNVNEAF 164


>SB_8803| Best HMM Match : Ras (HMM E-Value=7.9e-30)
          Length = 517

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 54/159 (33%), Positives = 87/159 (54%)
 Frame = +1

Query: 31  NLRLFIQITSNRRFGSGKNINTI*IF*RCI*HLLYIHNWYRL*NSNNRP*WQKS*ITNMG 210
           ++RL +Q   +R FGS K +++  I  R     L  ++  R  N N+   W+       G
Sbjct: 324 SVRLLVQDLIDRGFGSRKILSSSSIRRRLPQRELPDYDRSRFQNKNDESGWEA------G 377

Query: 211 YCWSREIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKC 390
               R I    +S  RG+ G+M+VYD+T  +S+ N+  W+  +E  AS  V  +++GNK 
Sbjct: 378 QERFRTI---TSSYYRGAHGVMIVYDITKRESYNNLHKWLMEVETYASEGVHMILVGNKI 434

Query: 391 DLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           DLD+ R+V  +  ++ A  + + FVETSAK + NV+ AF
Sbjct: 435 DLDTDREVQPDAAQEWAALHDMPFVETSAKGAKNVKEAF 473


>SB_53792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 85.0 bits (201), Expect = 6e-17
 Identities = 36/81 (44%), Positives = 57/81 (70%)
 Frame = +1

Query: 265 MGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAI 444
           +GI+LVYD+T E SF++I  W++NIE+NAS +V K++LGNK D + +R +  +RG  +  
Sbjct: 3   LGILLVYDITTEDSFKHISQWLQNIEDNASPNVCKVLLGNKLDAEDERVIDAQRGRSVGE 62

Query: 445 EYQIKFVETSAKDSLNVEYAF 507
           +  ++F E SA+   NV+ AF
Sbjct: 63  DNNLEFYEASARTGENVQQAF 83


>SB_27557| Best HMM Match : Ras (HMM E-Value=0)
          Length = 184

 Score = 85.0 bits (201), Expect = 6e-17
 Identities = 40/79 (50%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query: 20  KMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK-KVK 196
           +M   Y   F+++LIGDS VGK+S+L +F+E  F  +   T+G+DF +R ++L G  ++K
Sbjct: 5   RMKPKYFYQFRIILIGDSTVGKSSLLRQFTEGQFFENSDPTVGVDFHVRVLELKGDVRIK 64

Query: 197 LQIWDTAGQERFRTITTAY 253
           LQIWDTAGQERFR+IT +Y
Sbjct: 65  LQIWDTAGQERFRSITYSY 83



 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/88 (39%), Positives = 56/88 (63%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENAS-ADVEKMILGNKCDLDSQRQVSKE 423
           S  R ++G +++YD+TN  SF N+ +W +  ++    A+V  M++G+K D +S+R VS E
Sbjct: 82  SYYRNTVGCLIIYDITNRDSFVNVMDWYKEAKQCVEEAEVVFMLVGHKIDKESKRVVSTE 141

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            GE  A  + + F+ETSAK   N+E AF
Sbjct: 142 EGECFAEAHNMMFIETSAKVLCNIEEAF 169


>SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 271

 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 37/69 (53%), Positives = 52/69 (75%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK+L++GD GVGKTS++ RF++  F  +  ST+G+D   R +D+ G +VKLQ WDTAGQE
Sbjct: 12  FKVLVVGDPGVGKTSLIRRFTKGYFCDNSSSTVGVDVGTRVLDIHGDRVKLQCWDTAGQE 71

Query: 227 RFRTITTAY 253
           +FR IT +Y
Sbjct: 72  KFRGITQSY 80



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL-DSQRQVSKE 423
           S  R +  ++LV+D+TN  +F +I  W+ N+++  + ++ K+++GNK DL  + R+V+  
Sbjct: 79  SYYRNADAVILVFDITNRGTFASIPQWLMNVQKYTNKNILKVLVGNKTDLKGASRKVNTR 138

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGK 543
               LA   ++ ++ETSAK   NVE   +       EN K
Sbjct: 139 SAANLAEFEELLYLETSAKWDDNVEVLIAELAEQLRENAK 178


>SB_38511| Best HMM Match : Ras (HMM E-Value=1.2e-22)
          Length = 159

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 37/84 (44%), Positives = 54/84 (64%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+MG +LVYD+    SF N+  W+  + ++AS D+  +++GNK DL   R +   RG+Q
Sbjct: 14  RGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRGKQ 73

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A E+ + F+ETSA DS NV  AF
Sbjct: 74  FAAEHGMLFMETSALDSTNVAEAF 97


>SB_7589| Best HMM Match : Ras (HMM E-Value=0)
          Length = 640

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 34/70 (48%), Positives = 53/70 (75%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           +FK++L GD+ VGK+S + R   + F+ +  ST+G+DF+++T+ +DGK   LQ+WDTAGQ
Sbjct: 442 MFKIVLAGDAAVGKSSFILRLCRNRFHSALNSTLGVDFQMKTLVVDGKTYALQLWDTAGQ 501

Query: 224 ERFRTITTAY 253
           ERFR+I  +Y
Sbjct: 502 ERFRSIAKSY 511



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 34/92 (36%), Positives = 58/92 (63%), Gaps = 6/92 (6%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL------DSQR 408
           S  R + G++L+YDVT E SF ++++W+  IEE+ S  V  M+ GNK D+      +++ 
Sbjct: 510 SYFRKADGVLLLYDVTCETSFLDVRDWVEAIEESCSKPVPIMLCGNKIDIRQSAAAENKT 569

Query: 409 QVSKERGEQLAIEYQIKFVETSAKDSLNVEYA 504
            ++ E G +LA E+   F+ETS+K++ N+  A
Sbjct: 570 VITAESGSRLAKEHGALFIETSSKENKNIAEA 601


>SB_29253| Best HMM Match : Ras (HMM E-Value=2.8e-05)
          Length = 68

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 35/60 (58%), Positives = 48/60 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L RF+ + FN+   STIG++F  R+I +DGK +K QIWDT
Sbjct: 8   YDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT 67


>SB_44625| Best HMM Match : Ras (HMM E-Value=0)
          Length = 128

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 35/45 (77%), Positives = 43/45 (95%)
 Frame = +2

Query: 119 FNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           F+ S+I+TIG+DFKIRTI++DG+KVKLQIWDTAGQERFRTIT+ Y
Sbjct: 2   FSGSYITTIGVDFKIRTINIDGEKVKLQIWDTAGQERFRTITSTY 46



 Score = 68.9 bits (161), Expect = 4e-12
 Identities = 31/81 (38%), Positives = 54/81 (66%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+ G+++VYDVT+  +F N+K W+  I++N   DV ++++GNK D  S++ V     ++
Sbjct: 48  RGTHGVIVVYDVTSADTFVNVKRWLHEIDQNCD-DVIRILVGNKDDCPSKKVVETADLQK 106

Query: 436 LAIEYQIKFVETSAKDSLNVE 498
              +  I+  ETSAK+++NVE
Sbjct: 107 FGEQMNIRVFETSAKENINVE 127


>SB_8315| Best HMM Match : Ras (HMM E-Value=0)
          Length = 565

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 38/81 (46%), Positives = 56/81 (69%), Gaps = 11/81 (13%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTI-----------DLDGKK 190
           L K L +GDSGVGKTS+L+++++  FN  F+ TIGIDF+ + +              G++
Sbjct: 106 LIKFLALGDSGVGKTSLLYQYTDSHFNPRFVPTIGIDFREKRVVHHPLNPDGERSTRGQR 165

Query: 191 VKLQIWDTAGQERFRTITTAY 253
           + LQ+WDTAGQERFR++TTA+
Sbjct: 166 IHLQLWDTAGQERFRSLTTAF 186



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 15/35 (42%), Positives = 27/35 (77%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENA 351
           +  R +MG +LV+D+T+E+SF NI+NW+  ++ +A
Sbjct: 185 AFFRDAMGFLLVFDLTHEQSFVNIRNWLSQLQTHA 219



 Score = 35.1 bits (77), Expect = 0.063
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +1

Query: 370 MILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNV 495
           ++LGNK DL+  R V +     LA    +K+ ETSA    NV
Sbjct: 470 VLLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNV 511


>SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 365

 Score = 78.6 bits (185), Expect = 5e-15
 Identities = 36/68 (52%), Positives = 48/68 (70%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K++ +GD GVGK+S+  RF  D F   +  TIGIDF  +T+ LD  +V+LQIWDTAGQER
Sbjct: 165 KIVFLGDQGVGKSSLAGRFIYDIFEEKYQPTIGIDFMTKTVLLDDFEVRLQIWDTAGQER 224

Query: 230 FRTITTAY 253
           FR +  +Y
Sbjct: 225 FRCLIHSY 232



 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 30/89 (33%), Positives = 53/89 (59%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKE 423
           +S +R S   ++V+D+TN  SFE++ +W++ + +        +I+GNK D   +R+VS +
Sbjct: 230 HSYIRDSEAALIVFDITNYTSFESVGDWVKMVRDERGEKAVIIIVGNKMDESDRRKVSYD 289

Query: 424 RGEQLAIEYQIKFVETSAKDSLNVEYAFS 510
             E+ A    + +VETSAK   NV+  F+
Sbjct: 290 VAEKSAERLGLSYVETSAKSGYNVKLLFT 318


>SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44)
          Length = 212

 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 34/70 (48%), Positives = 49/70 (70%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           LFK++L+G++GVGKTS+ +R  E+ F     +TIGID   + + +  K+V L +WDTAG 
Sbjct: 11  LFKVVLLGEAGVGKTSLFYRLKENHFTPGRRNTIGIDSCSKFVKIGEKQVTLSVWDTAGV 70

Query: 224 ERFRTITTAY 253
           ERFRT+T  Y
Sbjct: 71  ERFRTVTKNY 80



 Score = 34.7 bits (76), Expect = 0.083
 Identities = 20/66 (30%), Positives = 37/66 (56%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   +L+++V +  S + + +WI + +E    D  K+++ NK DLD   QV+ E  E 
Sbjct: 82  RGAHACILMFNVDDPGSLQYLLHWIHDTDE-FCPDALKVLVANKIDLD--EQVTTESVEL 138

Query: 436 LAIEYQ 453
            A  ++
Sbjct: 139 FASSHE 144


>SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 265

 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 33/63 (52%), Positives = 47/63 (74%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           FK+++IGDS VGKT + +R     F     +TIG+DF  ++++L+G+ VKLQ+WDTAGQE
Sbjct: 47  FKIIIIGDSNVGKTCLAYRLCTGKFPERTETTIGVDFWEKSLELNGEFVKLQLWDTAGQE 106

Query: 227 RFR 235
           RFR
Sbjct: 107 RFR 109



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENA-SADVEKMILGNKCDLDSQRQVSKERGE 432
           R    ++ +YD+T + SFE +  WI     +A S DV K+++GNKCDL  +R VS     
Sbjct: 118 RNVNAVVFMYDITRKCSFEALTTWIVEYRHHAYSGDVPKILIGNKCDLGLERTVSSNIAR 177

Query: 433 QLAIEYQIKFVETSAKDSLNVE 498
           + A  + +   E S K+   +E
Sbjct: 178 KFADSHNMPLWEISIKNDAELE 199


>SB_8853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 30/61 (49%), Positives = 49/61 (80%)
 Frame = +2

Query: 35  YDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           YD LFK++LIGDSGVGK+++L R++++ F++   +TIG++   R ++++GK V+ QIWDT
Sbjct: 15  YDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDT 74

Query: 215 A 217
           A
Sbjct: 75  A 75


>SB_50855| Best HMM Match : Ras (HMM E-Value=0)
          Length = 733

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/71 (47%), Positives = 48/71 (67%)
 Frame = +2

Query: 41  CLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG 220
           C FKL+L+G+S VGK+S++ RF +  F+    STIG  F  +T+ LD   VK +IWDTAG
Sbjct: 20  CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAG 79

Query: 221 QERFRTITTAY 253
           QER+ ++   Y
Sbjct: 80  QERYHSLAPMY 90



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/84 (36%), Positives = 51/84 (60%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG+   ++VYD+TN+ +F   K W++ ++  AS ++   + GNK DL S+R V  E  + 
Sbjct: 92  RGAQAAIVVYDITNQDTFARAKTWVKELQRQASPNIVIALSGNKADLASKRMVEYEDAQS 151

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A +  + F+ETSAK ++NV   F
Sbjct: 152 YAEDNGLLFMETSAKTAMNVNDIF 175


>SB_10811| Best HMM Match : Ras (HMM E-Value=0)
          Length = 304

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 32/87 (36%), Positives = 55/87 (63%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  RG+ G +LVYD+++ ++F ++ NW+ +    AS ++  +++GNK DLD+ R+V+   
Sbjct: 163 SYYRGAAGALLVYDISSRETFNSLTNWLTDARTLASPNIVIILVGNKKDLDADREVTFLE 222

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAF 507
             + A E ++ F+ETSA    NVE  F
Sbjct: 223 ASRFAQENELMFLETSALTGENVEEGF 249



 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 23/38 (60%), Positives = 32/38 (84%)
 Frame = +2

Query: 140 TIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAY 253
           TIG++F  + +++ GK VKLQIWDTAGQERFR++T +Y
Sbjct: 127 TIGVEFGSKIVNVGGKSVKLQIWDTAGQERFRSVTRSY 164


>SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34)
          Length = 241

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 32/88 (36%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKER 426
           S  R   G+++ YD+T   +F+N+  W  ++++ A  +  K+++GNK DL+ +R+VS E 
Sbjct: 114 SYYRSCNGVIIAYDITKCDTFKNVIRWGEDVQKYAPENAIKLLVGNKKDLEREREVSLED 173

Query: 427 GEQLAIEY-QIKFVETSAKDSLNVEYAF 507
               A  Y  +  +ETSAKD+ N+E AF
Sbjct: 174 AVNCASHYGMLDVLETSAKDATNIEAAF 201



 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 19/21 (90%), Positives = 20/21 (95%)
 Frame = +2

Query: 191 VKLQIWDTAGQERFRTITTAY 253
           VKLQIWDTAGQERFRTIT +Y
Sbjct: 95  VKLQIWDTAGQERFRTITQSY 115


>SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 410

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 30/65 (46%), Positives = 43/65 (66%)
 Frame = +2

Query: 59  LIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRT 238
           L  D GVGK+S++ RF    F+     TIG++F  + + LDG+   LQIWDTAGQERF++
Sbjct: 216 LSSDGGVGKSSLMNRFVCGKFDTQSFHTIGVEFLNKDVKLDGESYTLQIWDTAGQERFKS 275

Query: 239 ITTAY 253
           + T +
Sbjct: 276 LRTPF 280



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RGS   +LVY V + KSF N+  W +     A   D +    ++LGNK D++  R VS+E
Sbjct: 282 RGSDLCLLVYAVDDAKSFTNLSMWKKEFLYYADVRDQDNFPFILLGNKVDVEG-RAVSQE 340

Query: 424 RGEQLAIEYQ-IKFVETSAKDSLNVEYAF 507
             +    +   + + ETSAKDS NV  AF
Sbjct: 341 EADSWCRQNGGVPYFETSAKDSTNVNDAF 369


>SB_29274| Best HMM Match : Ras (HMM E-Value=2.5e-05)
          Length = 152

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 26/60 (43%), Positives = 41/60 (68%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R   GI+LVYD+T  KSF+N++ W+ +I +N     E +++GNKCD+   R+V K +GE+
Sbjct: 54  RKGWGILLVYDITCRKSFDNLQFWLESIRKNKLQYEEILLVGNKCDVGDDREVPKRKGEE 113


>SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30)
          Length = 421

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 30/84 (35%), Positives = 44/84 (52%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           R +   +LVYD+T E +F +++ WIR ++     D+   + GNKCD   QR V  +  + 
Sbjct: 31  RDAAAAILVYDITIESTFHSLRPWIRELQRYGPQDIVIAVAGNKCDKADQRDVQVQDAQD 90

Query: 436 LAIEYQIKFVETSAKDSLNVEYAF 507
            A      F ETSA  S NV + F
Sbjct: 91  FAGSVDAIFAETSALTSKNVHWLF 114



 Score = 34.7 bits (76), Expect = 0.083
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +2

Query: 176 LDGKKVKLQIWDTAGQERFRTITTAY 253
           ++ K  K  IWDTAGQERF+++   Y
Sbjct: 4   VNDKAYKFNIWDTAGQERFKSLAPLY 29


>SB_11841| Best HMM Match : Ras (HMM E-Value=0)
          Length = 523

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 37/86 (43%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMIL-GNKCDLDSQRQVSKERG 429
           +R   G + V+ V N KSFE+I  +   I+    A+   M+L GNKCDL  QR VS    
Sbjct: 298 MRTGEGFLCVFAVNNSKSFEDINQYREQIKRVKDAEEVPMVLVGNKCDL-PQRTVSTSDA 356

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           ++LA  Y I F ETSAK    V+ AF
Sbjct: 357 QELAKSYNIPFQETSAKTRQGVDDAF 382


>SB_1286| Best HMM Match : Ras (HMM E-Value=2e-09)
          Length = 123

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 29/68 (42%), Positives = 40/68 (58%)
 Frame = +1

Query: 304 SFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKD 483
           SF+    WI ++      DV  M++GNK DL  +RQV+ E GE+ A E  + F+ETSAK 
Sbjct: 13  SFQQTSKWIDDVRTERGNDVIIMLVGNKTDLSDKRQVTAEEGERKAKELNVMFIETSAKA 72

Query: 484 SLNVEYAF 507
             NV+  F
Sbjct: 73  GYNVKQLF 80


>SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 216

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query: 11  IVVKMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTID-LDGK 187
           + ++M   Y   FK+L++GD   GK S + R+  + ++  +  TIG+DF ++TI      
Sbjct: 7   VPLQMLNQYTRNFKVLVVGDILTGKQSFVKRYVNNIWHPLYKPTIGVDFALKTIQWAQNT 66

Query: 188 KVKLQIWDTAGQERFRTITTAY 253
            ++LQIW  AGQERF ++T  Y
Sbjct: 67  TIRLQIWLIAGQERFSSMTRVY 88


>SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6116

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 26/61 (42%), Positives = 43/61 (70%)
 Frame = +2

Query: 50   KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
            KL+++GD   GKT +L  FS+D F   ++ T+  ++ +  I++DGK+V+L +WDTAGQE 
Sbjct: 5931 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY-VADIEVDGKQVELALWDTAGQED 5989

Query: 230  F 232
            +
Sbjct: 5990 Y 5990


>SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42)
          Length = 704

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 2/82 (2%)
 Frame = +2

Query: 14  VVKMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFI-STIGI-DFKIRTIDLDGK 187
           ++     +D  FK L+IG+SGVGK+ ++ +     F++ F+ ST+ + D        D K
Sbjct: 340 IISRQPNWDYEFKTLIIGNSGVGKSCLVNKLKNPHFDLKFVTSTVSMNDIFWEYFLYDNK 399

Query: 188 KVKLQIWDTAGQERFRTITTAY 253
           K+KL I DTAGQER+ +I  AY
Sbjct: 400 KIKLTIGDTAGQERYFSILPAY 421



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD--VEKMILGNKCDLDSQRQVSKERG 429
           RG  G+ LV+D+T E +F  +  WI      + AD  ++ +++GNK D++  R V+  R 
Sbjct: 423 RGVQGVFLVFDITVEITFLQLHRWIDLARTTSGADSNIQLILVGNKKDMEDNRAVTYSRA 482

Query: 430 EQLAIEYQIKFVETSAKD 483
           ++ A      ++ETSAKD
Sbjct: 483 KEFAAMNGFPYIETSAKD 500


>SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09)
          Length = 181

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 23/58 (39%), Positives = 36/58 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERG 429
           RG+MG +LVYD+    SF N+  W+  + ++AS D+  +++GNK DL   R +   RG
Sbjct: 14  RGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRG 71


>SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40)
          Length = 1265

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 22/67 (32%), Positives = 42/67 (62%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQ 435
           RG++G +LVYD+    ++EN++ W++ + ++A +++  M++GNK DL   R V  +  + 
Sbjct: 4   RGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEAKA 63

Query: 436 LAIEYQI 456
            A  Y I
Sbjct: 64  FAEIYHI 70


>SB_1277| Best HMM Match : DAO (HMM E-Value=6e-32)
          Length = 523

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 24/51 (47%), Positives = 39/51 (76%)
 Frame = +1

Query: 355 ADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           A+ + +++GNKCD++ +R VS +RG+QLA +  ++F ETSAKD+ NV+  F
Sbjct: 11  ANAQVILVGNKCDMEEERVVSYDRGKQLADQLGLEFYETSAKDNTNVKKVF 61


>SB_2880| Best HMM Match : Ras (HMM E-Value=3.2e-17)
          Length = 134

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNIEE-NASADVEKMILGNKCDLDSQRQVSKERG 429
           +R   G +++Y +T+  SF     +   IE    + D+  +++GNK DL+ +R+V+ + G
Sbjct: 6   MRNGEGFIIIYSITDRSSFNLAAQYKDQIERVRRTDDIPIVLVGNKDDLEGKREVTTQEG 65

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
           ++LA  +   F ETSA     V+ AF
Sbjct: 66  QELAHRFDCPFFETSACQRHFVDDAF 91


>SB_42246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 310

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 3/83 (3%)
 Frame = +1

Query: 268 GIMLVYDVTNEKSFENIKNW---IRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQL 438
           G ++VY +   ++FE  K     IR I++  +     ++ GNKCDL   R VS++   + 
Sbjct: 196 GFIVVYSINELRTFETAKQLVKLIREIKKQKALTTLIVLAGNKCDLKHCRAVSRQEAREF 255

Query: 439 AIEYQIKFVETSAKDSLNVEYAF 507
           A E++  F ETSA +++N +  F
Sbjct: 256 AAEHECVFHETSAANNINTKVIF 278



 Score = 35.1 bits (77), Expect = 0.063
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           + L+L+G +GVGK+++L RF    F   +  T+ + + + +  +D     L I DTA
Sbjct: 128 YSLVLLGQAGVGKSALLVRFCTGRFIHEYDPTLEMTYDV-SATIDEDPATLHITDTA 183


>SB_288| Best HMM Match : Ras (HMM E-Value=1.5e-11)
          Length = 220

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 24/89 (26%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +1

Query: 250 ILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD-SQRQVSKER 426
           I R   G ++V+DVT+ KSFE +  W+  ++E+   ++  +++GNK D   +  ++    
Sbjct: 42  IYRALSGAVIVFDVTDRKSFERVPTWLDKVQEHCGHEIPVVLVGNKTDRPLNSWKIPSNV 101

Query: 427 GEQLAIEYQIKFVETSAKDSLNVEYAFSL 513
             + A      ++ETSA    N++  F++
Sbjct: 102 AAKYATNNGFLYIETSALGMCNIDEIFAI 130


>SB_22528| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 467

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 26/61 (42%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL+++GD GVGK++ L   + +AF   +I T+  D     I LDGK   + +WDTAGQE 
Sbjct: 7   KLVVVGDGGVGKSAFLITATTNAFPGEYIPTV-FDNYSSNIMLDGKAYNVGLWDTAGQED 65

Query: 230 F 232
           +
Sbjct: 66  Y 66


>SB_39585| Best HMM Match : Ras (HMM E-Value=6e-35)
          Length = 145

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 5/89 (5%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-DVEK---MILGNKCDLDSQRQVSKE 423
           RG+   +LV+DVT   SF+ + +W       AS  D E    ++LGNK DL++ R VS +
Sbjct: 19  RGADCCVLVFDVTQPNSFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLEN-RAVSAK 77

Query: 424 RGEQLA-IEYQIKFVETSAKDSLNVEYAF 507
           R +     +  I + ETSAK+++NVE AF
Sbjct: 78  RAQAWCHSKNDIPYFETSAKEAINVEQAF 106



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = +2

Query: 203 IWDTAGQERFRTITTAY 253
           IWDTAGQERF+++  A+
Sbjct: 1   IWDTAGQERFQSLGVAF 17


>SB_1071| Best HMM Match : Ras (HMM E-Value=0)
          Length = 228

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           ++   G +LVY + N ++F ++K     I     S +V  +++GNK D+  +R+VS    
Sbjct: 56  IKNGQGFLLVYSLINRQTFADLKPMRAQILRVKGSENVPIVLVGNKSDIYDEREVSVGEA 115

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAFS 510
           + LA  +   F ETSAK   NV+  F+
Sbjct: 116 KDLAEAWGCPFYETSAKTRSNVDKVFA 142


>SB_17524| Best HMM Match : Ras (HMM E-Value=2.1e-10)
          Length = 159

 Score = 51.2 bits (117), Expect = 9e-07
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGID-FKIRTIDLDGKKVKL 199
           MA   D ++K+ L G  GVGKTSI  R S D F     S   ID   I  + +  KK+K+
Sbjct: 1   MAGPEDEVYKIALCGKMGVGKTSIYTRLSTDEFPEEEQSLHHIDQCFIPLVCICNKKLKI 60

Query: 200 QIWDTAGQERFRTIT 244
            +WDT G E + ++T
Sbjct: 61  HLWDTLGMEEYESLT 75


>SB_54971| Best HMM Match : Ras (HMM E-Value=0)
          Length = 239

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = +2

Query: 56  LLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFR 235
           L +GD G GKT+ + R     F   +I+T+G++            +K  +WDTAGQE+F 
Sbjct: 36  LQVGDGGTGKTTFVKRHLTGEFEKKYIATLGVEVHPLIFFTSRGPIKFNVWDTAGQEKFG 95

Query: 236 TITTAYSV 259
            +   Y +
Sbjct: 96  GLRDGYYI 103



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 21/78 (26%), Positives = 45/78 (57%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQ 453
           ++++DVT+  +++N+ NW R++ E    ++  ++ GNK D+   R+V K +      +  
Sbjct: 109 IIMFDVTSRVTYKNVPNWHRDL-ERVCENIPIVLCGNKVDI-KDRKV-KAKAITFHRKKN 165

Query: 454 IKFVETSAKDSLNVEYAF 507
           +++ + SAK + N E  F
Sbjct: 166 LQYYDLSAKSNYNFEKPF 183


>SB_37276| Best HMM Match : Ras (HMM E-Value=0.00045)
          Length = 100

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = +1

Query: 337 IEENASADVEKMILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           ++ N   + + +++GNKC LD +R+VS   G  LA E  + F ETSA+ ++NV   F
Sbjct: 1   MQHNCEQEAKAVLVGNKCHLDCEREVSVAEGRGLAKELGLPFFETSAEKNINVTDCF 57


>SB_11757| Best HMM Match : Ras (HMM E-Value=0)
          Length = 211

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 23/61 (37%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD GVGKTS+L  +  D F  S++ T    + + T++++ K   ++  DTAGQE 
Sbjct: 20  KCVIVGDGGVGKTSLLVSYMMDGFPNSYVPTAFDTYHV-TVEVNKKLCMIEFCDTAGQED 78

Query: 230 F 232
           F
Sbjct: 79  F 79


>SB_56256| Best HMM Match : Ras (HMM E-Value=8.9e-31)
          Length = 506

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 19/60 (31%), Positives = 40/60 (66%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERF 232
           ++L+GDS  GKT++L  +  + FN  + +T+  +     +++DG++++L +WDT+G E +
Sbjct: 235 VILVGDSECGKTALLNAYVRNQFNEKYEATV-FNSLSTAVEVDGERIELTLWDTSGHEDY 293


>SB_22751| Best HMM Match : Ras (HMM E-Value=0.0049)
          Length = 51

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +1

Query: 370 MILGNKCDLDSQRQVSKERGEQLAIEY-QIKFVETSAKDSLNVEYAF 507
           +++GNKCDL+ +R V K++G+ LA ++    F+ETSAK  +NV   F
Sbjct: 2   VLVGNKCDLEDERVVGKDQGQNLAKQFANCTFLETSAKAKINVNEIF 48


>SB_6223| Best HMM Match : Ras (HMM E-Value=0)
          Length = 1665

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +2

Query: 29  KTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIW 208
           K  D  +KL+++G  GVGK+++  +F +  F   +  TI   ++ + + +D +   L I 
Sbjct: 6   KDVDKQYKLVVVGGGGVGKSALTIQFIQSHFVSDYDPTIEDSYRKQCV-IDERVAHLDIL 64

Query: 209 DTAGQERFRTITTAY 253
           DTAGQE F  +   Y
Sbjct: 65  DTAGQEEFSAMREQY 79



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +1

Query: 253 LRGSMGIMLVYDVTNEKSFENIKNWIRNI-EENASADVEKMILGNKCDLDSQRQVSKERG 429
           +R   G +LV+ VT+  SFE I  +   I       +   +I GNK DL+ +R VS   G
Sbjct: 80  MRSGEGFLLVFSVTDRSSFEEINKFYNQILRVKDRTEFPMIICGNKSDLEYERTVSTAEG 139

Query: 430 EQLA 441
           ++LA
Sbjct: 140 QELA 143


>SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASA-----DVEKMILGNKCDLDSQR 408
           N   + + G +LVYDVT+ +SFE +  W+  I+++  +      V  ++  NK D   +R
Sbjct: 8   NEFYKDTQGALLVYDVTSRESFEALDIWLDEIKKDIGSPSDFNSVVFVVCANKVD-SRKR 66

Query: 409 QVSKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
            V +  G Q A  ++  + ETSA+    +   F
Sbjct: 67  LVEESEGRQWAENHKFCYFETSAQTGDGIPEVF 99


>SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13)
          Length = 322

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 2/85 (2%)
 Frame = +1

Query: 229 IPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD--VEKMILGNKCDLDS 402
           IP   +S+      +++ YDV+NE+SF     W+      A +D  +   ++  K DL  
Sbjct: 51  IPETTDSVWEHPNLVIVAYDVSNEQSFNACNKWLERCRSLAKSDNNLPGALIATKTDLKQ 110

Query: 403 QRQVSKERGEQLAIEYQIKFVETSA 477
           +R +S ++G+  A    +++ E SA
Sbjct: 111 RRVISTKQGKDYANSKNLEYFECSA 135



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 12/45 (26%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDA--FNISFISTIGIDFKIRTIDL 178
           K+L+ GDS VGK++++  F  D   +  ++  T+G +  ++ +++
Sbjct: 7   KVLVTGDSCVGKSALVQVFQSDGTHYPKNYTQTVGAEVLVKLVNI 51


>SB_12762| Best HMM Match : Ras (HMM E-Value=2.2e-21)
          Length = 242

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 25/62 (40%), Positives = 36/62 (58%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           F ++  G S VGKTS++ RF   AFN  +  TI  DF I+ +  + +  +LQI DT+G  
Sbjct: 29  FTIVFFGASSVGKTSLILRFLGYAFNDDYSPTIE-DFFIKHVFFNNETYELQIIDTSGTY 87

Query: 227 RF 232
            F
Sbjct: 88  EF 89


>SB_12958| Best HMM Match : Ras (HMM E-Value=6e-13)
          Length = 168

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 4/91 (4%)
 Frame = +1

Query: 247 SILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASAD----VEKMILGNKCDLDSQRQV 414
           S +    G ++VY +T+  S+E  +  ++ + +    D    +  +++GNK DL   R V
Sbjct: 29  SYIHNGDGFVVVYSITDYYSYEMARQLVKLVTQVRKTDDICQIPIVLVGNKRDLRRGRCV 88

Query: 415 SKERGEQLAIEYQIKFVETSAKDSLNVEYAF 507
           +K+   + A EY     ETSA  + NV   F
Sbjct: 89  AKDEAREFASEYGCSHYETSALTNRNVHVIF 119


>SB_22529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D   K++ +GD  VGKTS L+  +   F   FI++I  D   +T+++DGK+  + + DT 
Sbjct: 7   DPTIKVVFVGDKNVGKTSFLYAATTHNFPTGFIASI-FDGYSKTMEIDGKRYTVLLCDTP 65

Query: 218 G 220
           G
Sbjct: 66  G 66


>SB_47462| Best HMM Match : Ras (HMM E-Value=0)
          Length = 385

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 23/69 (33%), Positives = 40/69 (57%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K++++G  GVGK+++  +F    F   +  TI  DF  + I++D     L+I DTAG E
Sbjct: 4   YKVVVLGSGGVGKSALTVQFVTGQFVEKYDPTIE-DFYRKEIEVDNNPSILEILDTAGTE 62

Query: 227 RFRTITTAY 253
           +F ++   Y
Sbjct: 63  QFASMRDLY 71


>SB_6284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K +++GD  VGKT +L  ++ + F   ++ T+  ++ + T+ + G+   L ++DTAGQE 
Sbjct: 5   KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAV-TVMIGGEPYTLGLFDTAGQED 63

Query: 230 F 232
           +
Sbjct: 64  Y 64


>SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15)
          Length = 857

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 6/101 (5%)
 Frame = +1

Query: 262  SMGIMLVYDVTNEKSFENIKNWIRNIEEN----ASADVEKMILGNKCDLDSQRQV--SKE 423
            ++G  +V+DVT   +F  ++ W  +++      +   +  ++L NKCD   +  V  S +
Sbjct: 714  AVGAFIVFDVTRASTFSAVQKWKNDLDNKLQLPSGEPIPAVLLANKCDQAKEGLVNNSAQ 773

Query: 424  RGEQLAIEYQIKFVETSAKDSLNVEYAFSL*PGTKSENGKE 546
              E  A +  I + ETSAK+ +NV  A         +N KE
Sbjct: 774  MDEYCADKGFIGWFETSAKEDVNVNEAAKFLVSKILQNEKE 814



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/37 (43%), Positives = 27/37 (72%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGID 154
           LFK+L+IGD GVGKTS++ R+    F++ + +T+  +
Sbjct: 671 LFKVLVIGDLGVGKTSLIKRYVHQFFSVHYRATVSFN 707


>SB_24106| Best HMM Match : Ras (HMM E-Value=1e-35)
          Length = 263

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/62 (37%), Positives = 39/62 (62%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
           D ++++ L+GD GVGKT++L RF    F   +  TI   ++ ++I++D   V L+I DTA
Sbjct: 3   DHVYRIALLGDEGVGKTALLVRFLCHRFLGEYDPTIEDKYR-KSINIDDVTVTLEILDTA 61

Query: 218 GQ 223
            +
Sbjct: 62  SR 63


>SB_11310| Best HMM Match : Arf (HMM E-Value=0)
          Length = 255

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +LL++G    GKT+IL+    D   ++ I TIG + ++    ++ K +K  +WD  GQ++
Sbjct: 92  RLLMVGLDAAGKTTILYHLKLDE-PVNTIPTIGFNVEV----VEYKNIKFTVWDIGGQDK 146

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 147 IRLLWRLY 154


>SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05)
          Length = 243

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 9/85 (10%)
 Frame = +2

Query: 26  AKTYDCLFKLLLIGD-SGVGKTSILFRFSEDAFNISFIS--TIGIDFKIRTID---LDGK 187
           ++  D  FK++ +GD +G GK             +SF    TIG+DF +  I+    D K
Sbjct: 44  SRASDHTFKIMCVGDYTGFGKKGGFLSDYIHNRPLSFYQKPTIGVDFYVHFIEWRETDKK 103

Query: 188 K---VKLQIWDTAGQERFRTITTAY 253
           K   VKLQ WD A  ERF  +T  Y
Sbjct: 104 KDSTVKLQFWDVAEHERFLKMTAVY 128


>SB_37042| Best HMM Match : Arf (HMM E-Value=0)
          Length = 188

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +++++G    GKT+IL++       +S I TIG  F + T+    K V L IWD  GQ++
Sbjct: 21  RIVMLGLDAAGKTTILYKLKLKE-TVSTIPTIG--FNVETLQ-PTKNVTLTIWDVGGQDK 76

Query: 230 FRTITTAY----SVVLWELCLSTMLRMRRALKTL 319
            R +   Y      +L+ +  S +LRM  A + L
Sbjct: 77  IRPLWRHYFQGTEGLLFVVDSSDVLRMPEAKEEL 110


>SB_33691| Best HMM Match : Ras (HMM E-Value=2.8e-13)
          Length = 270

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQE 226
           +K+ ++G  GVGKTS+L  F    F+   + T+  D+ I ++++DG      I DTAG  
Sbjct: 13  YKISILGAGGVGKTSLLKTFFGHKFSEKHVPTVD-DYFIHSVNMDGVYYSTCIVDTAGTY 71

Query: 227 RF 232
            F
Sbjct: 72  AF 73


>SB_56255| Best HMM Match : Arf (HMM E-Value=0)
          Length = 181

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + T++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVETVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>SB_52002| Best HMM Match : Ras (HMM E-Value=2.3e-19)
          Length = 351

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGK-KVKLQIWDTAG 220
           +F+++++G  GVGKTS++ RF    F+  +  T+G D   +++ L       L+I DTAG
Sbjct: 107 VFRVVVLGSGGVGKTSLVKRFISGTFSEQYTPTVG-DLYEKSVTLSKDFNAFLEIMDTAG 165

Query: 221 QERF 232
              F
Sbjct: 166 SYPF 169



 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/79 (22%), Positives = 30/79 (37%)
 Frame = +1

Query: 220 SREIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLD 399
           S   P      ++ +   +LVY V  + S +      R I       V  +++GNK DL 
Sbjct: 166 SYPFPAMKKLTIQNADAFVLVYSVDEKASLQEALELQREIVYIKGKTVPMVLVGNKTDLV 225

Query: 400 SQRQVSKERGEQLAIEYQI 456
           S+      R +     Y +
Sbjct: 226 SEELRQSTRAQMRKTNYAV 244


>SB_45967| Best HMM Match : Ras (HMM E-Value=2.1e-07)
          Length = 92

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           K+ ++G   VGK+S+  +F E  F  S+  TI   F  + I   G++  L++ DTAGQ+ 
Sbjct: 8   KIAVMGFRSVGKSSLTIQFVEGQFVDSYDPTIENTFT-KNIKYKGQEFFLELVDTAGQDE 66

Query: 230 FRTITTAYSV 259
           +     +YS+
Sbjct: 67  YSIFPQSYSM 76


>SB_53421| Best HMM Match : Arf (HMM E-Value=0)
          Length = 625

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +2

Query: 59  LIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRT 238
           +IG    GKT+IL+R   +   +S + T+G  F + T+    K +   +WD  GQ++ R 
Sbjct: 1   MIGLDNAGKTTILYRLKLEEV-VSTVPTLG--FNVETVTY--KNISFTVWDIGGQDKIRA 55

Query: 239 ITTAY 253
           +   Y
Sbjct: 56  LWRVY 60


>SB_1645| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 244

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +1

Query: 238 NNNSIL-RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADV 363
           N+ SI   G  G++LV+D+TN KSF N++ W+  +  NAS D+
Sbjct: 75  NSRSIFYNGINGLILVHDLTNRKSFTNLRKWLAEV-LNASKDL 116



 Score = 37.1 bits (82), Expect = 0.016
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 5/96 (5%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDL-----DGKKVKLQIWDT 214
           ++ ++GDSGVGKTS++     +    S   TIG   +++  D       GK   L+ WD 
Sbjct: 8   RIAVVGDSGVGKTSLVHLICHEESISSAAWTIGCTVEVKLYDYKEGMPGGKTFFLEFWDI 67

Query: 215 AGQERFRTITTAYSVVLWELCLSTMLRMRRALKTLR 322
            G        + +   +  L L   L  R++   LR
Sbjct: 68  GGSANHENSRSIFYNGINGLILVHDLTNRKSFTNLR 103


>SB_42281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/68 (27%), Positives = 37/68 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           ++L++G    GKT+IL++       ++ I TIG  F + +++   K +   +WD  GQ++
Sbjct: 19  RILMVGLDAAGKTTILYKLKLGEI-VTTIPTIG--FNVESVEY--KNISFTVWDVGGQDK 73

Query: 230 FRTITTAY 253
            R +   Y
Sbjct: 74  IRPLWRHY 81


>SB_10598| Best HMM Match : LRR_1 (HMM E-Value=4.4e-19)
          Length = 811

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 2/64 (3%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSE-DAFNISF-ISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
           KL+L+G+SG GKTS      E +A N +    T+G+  +   ++ DG  +++Q+ D AGQ
Sbjct: 262 KLVLLGESGAGKTSCAHGLVECEAINQTLNDGTVGVVIRNWQVEPDG--LEVQVVDCAGQ 319

Query: 224 ERFR 235
            R++
Sbjct: 320 RRYQ 323


>SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31)
          Length = 357

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDLDSQRQVSKERGE 432
           +GS  I+L +D++N ++FE I++ W+    +     + ++++GNK D+   RQ    RG+
Sbjct: 74  QGSDIILLCFDISNRQTFERIESKWLPETTQVLPGSI-RVLIGNKNDIRKTRQDKDRRGK 132

Query: 433 QL 438
            L
Sbjct: 133 VL 134



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 3/68 (4%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAG--- 220
           K++L GD+ VGKTS L   +++   +    T   ++++  +++  +K  L +WDT G   
Sbjct: 8   KVVLTGDNNVGKTSFLINLTQN--ELEGTPTAFANYEL-GLEVGSQKFLLDLWDTEGTTE 64

Query: 221 QERFRTIT 244
            +R R +T
Sbjct: 65  YDRLRPLT 72


>SB_22530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           KL ++GD  VGKT++    + + F   +I T     +    ++DG K +  ++D+AG E 
Sbjct: 8   KLYIVGDGAVGKTALFITAATNTFPTEYIPTAYDASEQDFFNVDGIKYQAVLFDSAGGED 67

Query: 230 F 232
           F
Sbjct: 68  F 68


>SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +2

Query: 179 DGKKVKLQIWDTAGQERFRTITTAY 253
           +G+ ++L +WDTAGQE F  IT AY
Sbjct: 30  NGEDIRLMLWDTAGQEEFDAITKAY 54


>SB_39092| Best HMM Match : Arf (HMM E-Value=8e-36)
          Length = 260

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQER 229
           +L L+G    GKT+ +   +   F+   I T+G  F +R +      V +++WD  GQ R
Sbjct: 22  ELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVG--FNMRKVSKGN--VTIKVWDIGGQPR 77

Query: 230 FRTITTAY 253
           FR++   Y
Sbjct: 78  FRSMWERY 85


>SB_38760| Best HMM Match : Ras (HMM E-Value=4.6e-06)
          Length = 965

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 17/60 (28%), Positives = 37/60 (61%)
 Frame = +2

Query: 44   LFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQ 223
            + K+++IG+ GVGK+++  RF    F   +  T+   ++ +  ++ G+ V +++ DTAG+
Sbjct: 861  IVKVVIIGEDGVGKSALTVRFLTKRFIGEYDDTLESTYR-QDAEVAGEVVAIELTDTAGE 919


>SB_54000| Best HMM Match : MMR_HSR1 (HMM E-Value=1.8)
          Length = 65

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 17  VKMAKTYDCLFKLLLIGDSGVGKTSILFRF 106
           +K  K  D L K+LLIGDS VGKT +L  F
Sbjct: 3   MKPRKKQDYLLKVLLIGDSNVGKTKLLLTF 32


>SB_18358| Best HMM Match : Arf (HMM E-Value=0)
          Length = 214

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGID-FKIRTIDLDGKKVKLQIWDTAGQ 223
           F ++++G    GKTSIL+R   + F   +++T+    F + TI    K ++ ++WD  G+
Sbjct: 22  FHVVMLGLDKSGKTSILYR---NKFR-EYVNTVPTTAFNVETIR-PFKGIRFKVWDIGGR 76

Query: 224 ERFRTITTAYS 256
           E+ R +  AY+
Sbjct: 77  EQNRPLWKAYA 87


>SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35)
          Length = 2748

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +2

Query: 38   DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTA 217
            + +F+L ++G  GVGK+S+  R+ ++ F                ID  GK   +++ DTA
Sbjct: 2596 ETMFRLCVVGSGGVGKSSVTIRYLKNEFT--------------EIDYCGKLYDIEVVDTA 2641

Query: 218  GQERF 232
            GQE +
Sbjct: 2642 GQEEY 2646


>SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1325

 Score = 35.1 bits (77), Expect = 0.063
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +2

Query: 20  KMAKTYDCLFKLLLIGDSGVGKTSILFRF-SEDAFNISFISTIGIDFKIRTIDLDGKKVK 196
           K+    D   ++LL+G    GKT+IL    SED  +I+   T G  F I+++   G   +
Sbjct: 9   KLKSEKDREMRILLLGLDNSGKTTILKSLASEDVLHIT--PTQG--FNIKSVQSKG-GFR 63

Query: 197 LQIWDTAGQERFR 235
           L +WD  GQ + R
Sbjct: 64  LNVWDIGGQRKIR 76


>SB_8139| Best HMM Match : Ras (HMM E-Value=0.02)
          Length = 96

 Score = 34.7 bits (76), Expect = 0.083
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = +1

Query: 373 ILGNKCDLDSQRQVSKERGEQLAIEYQIKFVETSAKDSLNV 495
           +LGNK DL+  R V +     LA    +K+ ETSA    NV
Sbjct: 2   LLGNKADLEDDRVVDEAEARALADNLGLKYFETSAATGQNV 42


>SB_31701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 7/93 (7%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILF----RFSEDAFNISF---ISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +L++G    GKT++L     +F +    I F    +T+G++    TI      VKL  WD
Sbjct: 24  ILILGLDNAGKTTLLEQIKRKFCKTYNGIPFEKITTTVGLNIGKITIS----HVKLMFWD 79

Query: 212 TAGQERFRTITTAYSVVLWELCLSTMLRMRRAL 310
             GQ+  RT+     V+  ++ ++  L +  AL
Sbjct: 80  LGGQQELRTLWDKVEVMSVKILMTRFLPVEEAL 112


>SB_31439| Best HMM Match : Ras (HMM E-Value=4.7)
          Length = 55

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 13/35 (37%), Positives = 23/35 (65%)
 Frame = +1

Query: 244 NSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEEN 348
           N   + + G +LVYDVT+ +SFE +  W+  I+++
Sbjct: 3   NEFYKDTQGALLVYDVTSRESFEALDIWLDEIKKD 37


>SB_7861| Best HMM Match : MMR_HSR1 (HMM E-Value=0.96)
          Length = 244

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           FK+ ++G S VGKTS++    +  F    I TI  D+ I  ++ DG    + + DT
Sbjct: 188 FKMAILGGSAVGKTSLMRALFKKPFTNEHIPTID-DYIIHALNQDGVHYNVCLVDT 242


>SB_5178| Best HMM Match : Ras (HMM E-Value=9e-10)
          Length = 166

 Score = 33.5 bits (73), Expect = 0.19
 Identities = 20/70 (28%), Positives = 38/70 (54%)
 Frame = +2

Query: 23  MAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQ 202
           M +  + L ++ + G +GVGKTSI+ RF    F+  +  T+  D   + ++ +G  + L 
Sbjct: 1   MKEKRNSLHEIAVFGGAGVGKTSIVKRFYCGKFSEEYEPTVE-DCYSKVLNKNGSIMVLN 59

Query: 203 IWDTAGQERF 232
             D++G  +F
Sbjct: 60  TTDSSGSYQF 69



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 10/57 (17%)
 Frame = +1

Query: 367 KMILGNKCDLDSQRQVSKER--GEQLAI--------EYQIKFVETSAKDSLNVEYAF 507
           K   GNK DL+ QR+VS E+   E +A         +  ++ VETSAKD  N+   F
Sbjct: 78  KRASGNKKDLEEQREVSSEQVVKEVMAFAREKGCEGKLNMRQVETSAKDDCNISDVF 134


>SB_33026| Best HMM Match : Ras (HMM E-Value=3.7e-08)
          Length = 155

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 25/87 (28%), Positives = 39/87 (44%)
 Frame = +1

Query: 223 REIPYNNNSILRGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDLDS 402
           +  P   +++L  +  + L+Y VT+  SFE      R I++N      K I+    DL  
Sbjct: 44  KNTPDKVDALLEAANIVYLLYSVTDRASFEEAAWLARRIQQN------KAIVATNKDLKH 97

Query: 403 QRQVSKERGEQLAIEYQIKFVETSAKD 483
             QV +  G  LA E    FV+ S  +
Sbjct: 98  LSQVLEYEGRFLAQELDGLFVQVSISE 124


>SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2229

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
 Frame = +2

Query: 8   RIVVKMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGI---DFKIRTIDL 178
           R  ++ A+ Y  + KL+L+G    GKT+++ R   D       +T GI   +F+++  D 
Sbjct: 540 RAKLRSARGYYSM-KLMLVGREAQGKTTLMHRLMLDNTYFINSATNGISMEEFRLKK-DF 597

Query: 179 DGKKVKLQIWDTAGQERF 232
             ++   +IWD  GQE +
Sbjct: 598 LHREFIFKIWDFGGQEDY 615


>SB_33999| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 38  DCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIG 148
           + LFK+L++GD+ VGKTS + R+        +  TIG
Sbjct: 20  EILFKVLIVGDATVGKTSFVQRYVHGNTRREYKPTIG 56


>SB_43575| Best HMM Match : Sina (HMM E-Value=0)
          Length = 432

 Score = 32.7 bits (71), Expect = 0.33
 Identities = 19/71 (26%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
 Frame = +1

Query: 256 RGSMGIMLVYDVTNEKSFENIKNWIRNIEENASADVEKMILGNKCDL--DSQRQVSKERG 429
           RG+   ++ YD+T E S + + +   ++ + A  +   +I+G K DL  D  R++++  G
Sbjct: 294 RGASAAIVAYDITKESSLKVLNDRHLHLLQAAEPNCLVVIVGCKKDLVTDDTREITEAAG 353

Query: 430 EQLA-IEYQIK 459
            +LA ++ ++K
Sbjct: 354 MELAKVQNELK 364


>SB_35222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 267

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 16/56 (28%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFR--FSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWD 211
           +++++GDS VGKT +L +  +  +  +   + +I  ++ +  I +DGK  KL++ D
Sbjct: 20  RIVILGDSTVGKTCLLLQLCYKSNTMSRKHLESISNNY-VANIIVDGKVYKLELCD 74


>SB_51788| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 414

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENI-KNWIRNIEENASADVEKMILGNKCDLDSQRQVSKERGEQL 438
           +L +DVTN  SFEN+   W   I       V  M++G K +   +R+VSK   E++
Sbjct: 101 ILCFDVTNRASFENVASKWFPEI-RLYEKKVPLMLVGLKPNPVEKRKVSKADAERM 155


>SB_51370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 17/68 (25%), Positives = 36/68 (52%)
 Frame = +2

Query: 20  KMAKTYDCLFKLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKL 199
           K   T +    + ++G  GVGK++   R     F   +   + +++K  ++++DG+ + L
Sbjct: 173 KSFMTNNRALSVAVLGKDGVGKSAFTVRALTRRFIGEYDPFLELNYK-HSMEIDGQYLAL 231

Query: 200 QIWDTAGQ 223
            + DTAG+
Sbjct: 232 DVLDTAGK 239


>SB_15460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 419

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +1

Query: 562 SVGR*EWRPQADAERRSQAGDVAVALQRALTPSAHYDPRPSPIL 693
           S+GR + +   + E++S   +   A +R  +P+AH  P P+P++
Sbjct: 37  SLGRSKKKESKNLEKKSSIDEKDAARKRMHSPAAHAPPGPAPVV 80


>SB_49252| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 384

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNIS----FISTIGIDFKIRTIDLDGKKVKLQIWDT 214
           +K++L+GD+GVGK+ ++ R +  + +      +  T G      T         L + DT
Sbjct: 14  YKVVLVGDAGVGKSFVIDRLNSTSEHWQGSRLYKPTTGGHASYFTA---SNSCHLYLLDT 70

Query: 215 AGQERFRTITTAY 253
           +G E +R +T  Y
Sbjct: 71  SGLEEYRELTKIY 83


>SB_15868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1103

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV 193
           +++LIG    GKTS+        F+ S +ST GI+    T ++D ++V
Sbjct: 292 RIMLIGQDRAGKTSLKKSLFGIPFDPSEVSTEGIEVDPSTFEVDVEQV 339


>SB_7780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1309

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 6/86 (6%)
 Frame = +1

Query: 268 GIMLVYDV--TNEKSFENIKNWIRN--IEENASADVEKMILGNKCDLDSQRQVSKE--RG 429
           G +++YDV  TN K  E+ +  + +  I     +    +I+ +KCD D+Q  + +E  R 
Sbjct: 157 GFLVLYDVEATNAKRLEDTQEKVLSAVITYVQKSKRPFVIVASKCD-DTQLSLLQEVYRF 215

Query: 430 EQLAIEYQIKFVETSAKDSLNVEYAF 507
            Q   +  +  VETS   ++NV+ AF
Sbjct: 216 AQTK-KLNVPIVETSTYQNVNVDLAF 240


>SB_35075| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1184

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/22 (50%), Positives = 17/22 (77%)
 Frame = +1

Query: 442 IEYQIKFVETSAKDSLNVEYAF 507
           +++ + F+ETSAK  LNV+ AF
Sbjct: 148 MDHNVAFMETSAKTGLNVDLAF 169


>SB_34024| Best HMM Match : VLPT (HMM E-Value=3.7)
          Length = 368

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/34 (32%), Positives = 22/34 (64%)
 Frame = +2

Query: 47  FKLLLIGDSGVGKTSILFRFSEDAFNISFISTIG 148
           + ++++G +GVGKT+++ RF    F   +  T+G
Sbjct: 325 YSMVVLGAAGVGKTALVVRFVTGRFLNEYDPTLG 358


>SB_57342| Best HMM Match : Arf (HMM E-Value=0)
          Length = 457

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +2

Query: 71  SGVG-KTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITT 247
           SG G KT+IL++       ++ + T+   F + TI    K +   +WD  GQ++ R +  
Sbjct: 117 SGRGRKTTILYKLKLKE-TVNTVPTVA--FNVETIS-PCKNITFSVWDIGGQDKIRRLWR 172

Query: 248 AY 253
            Y
Sbjct: 173 HY 174


>SB_53179| Best HMM Match : BTB (HMM E-Value=3.3e-21)
          Length = 604

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/42 (26%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +1

Query: 274 MLVYDVTNEKSFENIKN-WIRNIEENASADVEKMILGNKCDL 396
           ++ +D+TN  SF+N+   W+  + ++   +   +++GNK D+
Sbjct: 97  IICFDITNPTSFQNVSTVWVPEL-KHYMPETPVLVVGNKKDM 137



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/19 (57%), Positives = 16/19 (84%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRF 106
           KL ++GD+ VGKT IL+R+
Sbjct: 10  KLKVVGDTNVGKTCILYRW 28


>SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 908

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGID 154
           +LL+G  GVGKT ++ + + D   I  +ST G D
Sbjct: 248 ILLVGAPGVGKTLLVHKATVDC-GIKLVSTNGTD 280


>SB_17523| Best HMM Match : MMR_HSR1 (HMM E-Value=4.2)
          Length = 87

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 44  LFKLLLIGDSGVGKTSILFRFSEDAF 121
           L+K++  G  GVGKTS+  R  ++ F
Sbjct: 27  LYKVVFAGFRGVGKTSLFLRIRDEKF 52


>SB_53088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKV----KLQIWDTA 217
           +++LIG    GKTS+        F+   +ST GI+    T ++D ++V    +L   D A
Sbjct: 83  RIMLIGQDRAGKTSLKKSLLGIPFDPGEVSTEGIEVDPSTFEVDVEQVSRWQRLCDSDKA 142

Query: 218 GQERFRTITTAYSVVLWEL 274
           G    +++     ++  EL
Sbjct: 143 GNSNNQSVRALARLIAEEL 161


>SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +2

Query: 53  LLLIGDSGVGKTSILFRFSEDAFNISFISTIGID 154
           +LL+G  GVGKT ++ + + D   I  +ST G D
Sbjct: 78  ILLVGAPGVGKTLLVHKATVDC-GIKLVSTNGTD 110


>SB_47450| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +2

Query: 146 GIDFKIRTIDLDGKKVKLQIWDTAGQERFRTITTAYSV 259
           G+   IRT D+   +  L++ D  G+ER   +T  YS+
Sbjct: 39  GLHLNIRTADIVNLRTMLELLDVEGEERH--VTLPYSI 74


>SB_34906| Best HMM Match : Cadherin (HMM E-Value=0)
          Length = 3922

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 19/67 (28%), Positives = 31/67 (46%)
 Frame = -2

Query: 258  TEYAVVIVRNLS*PAVSHICNLTFLPSRSIVRILKSIPIVDIKEMLNASSENLNSIDVFP 79
            T  A VIVR+++  AVS+   L     R +   +     V + E+      + + I+VF 
Sbjct: 2648 TSRATVIVRDITSKAVSNSVALQISDMRKVEYFVGDYHDVVVGELSRMFGVSSSGIEVFS 2707

Query: 78   TPESPIR 58
               SPI+
Sbjct: 2708 VQPSPIK 2714


>SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1420

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 50  KLLLIGDSGVGKTSILFRFSEDAFNISFISTIGIDFKIRTIDLDGKKVK 196
           +++LIG    GKTS+        F+   +ST GI+    T ++D  +VK
Sbjct: 361 RIMLIGQDRAGKTSLKKSLLGLPFDPREVSTEGIEVDPSTFEVDIDQVK 409


>SB_13497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 434

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 16/54 (29%), Positives = 31/54 (57%)
 Frame = -2

Query: 171 IVRILKSIPIVDIKEMLNASSENLNSIDVFPTPESPIRSNLNKQS*VFAIFTTI 10
           +V  + S+ IV    + + + EN+  +++  TP+S  ++ + KQ+ V AI T I
Sbjct: 47  LVDDVNSVKIVTGDVIHDFAGENVKYLELRSTPKSNPKTGMTKQAYVDAILTAI 100


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,453,203
Number of Sequences: 59808
Number of extensions: 487365
Number of successful extensions: 1483
Number of sequences better than 10.0: 108
Number of HSP's better than 10.0 without gapping: 1330
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1449
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2082369341
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -