SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20002
         (732 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23)                   29   3.9  
SB_19996| Best HMM Match : PKD_channel (HMM E-Value=0)                 28   6.8  
SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73)          28   9.0  
SB_6198| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-18)                  28   9.0  

>SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1805

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = -2

Query: 308 RKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRIC 207
           +K+H VPP+ +A  +TD++ RS +  ++ Q  +C
Sbjct: 138 KKRHEVPPHIYA--ITDTAYRSMLQDRENQSILC 169


>SB_52818| Best HMM Match : CUB (HMM E-Value=1.6e-23)
          Length = 898

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 17/61 (27%), Positives = 33/61 (54%)
 Frame = -2

Query: 326 RHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDLQRRICIRTA*GDTVLLVARVLQSIV 147
           + E+++R  +SVP    + ++T +   ++ SS D  +R CI+    D   L+A  L  ++
Sbjct: 345 KDEASMRPIYSVPYTGKSHALTPTPTENSNSSHDKFKRACIQGGAPDNTPLIAIPLVCML 404

Query: 146 V 144
           V
Sbjct: 405 V 405


>SB_19996| Best HMM Match : PKD_channel (HMM E-Value=0)
          Length = 746

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +3

Query: 543 FVSGIMSVIVFFLFIKIISLERF 611
           ++  +M +IVFF FIKI+ L RF
Sbjct: 225 WIKCLMGLIVFFSFIKIVRLLRF 247


>SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73)
          Length = 150

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 487 IVIFCYFRYSETKHTNKP 434
           IV FC++RY   +H  KP
Sbjct: 113 IVFFCWWRYKRRRHNQKP 130


>SB_6198| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-18)
          Length = 347

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 344 LYCVLDRHESTVRKKHSVPPNDFAFSVTDSSRRSTMSSQDL 222
           +Y VL RH+  ++ +H V   D  F++  +  R +++S  L
Sbjct: 202 IYRVLRRHKIQIKSQHQVQERDAGFTLNMARYRKSVTSMFL 242


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,601,042
Number of Sequences: 59808
Number of extensions: 406132
Number of successful extensions: 1070
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1070
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1962001171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -