SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      199   2e-51
SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      161   4e-40
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             130   2e-30
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       125   4e-29
SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   3e-10
SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)                 63   3e-10
SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)              58   1e-08
SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)                 42   7e-04
SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.75 
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 31   0.99 
SB_7343| Best HMM Match : EGF (HMM E-Value=0)                          30   2.3  
SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3)            29   3.0  
SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.3  
SB_9053| Best HMM Match : TIG (HMM E-Value=0)                          29   5.3  
SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.3  
SB_24762| Best HMM Match : Astacin (HMM E-Value=0)                     28   7.0  
SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3)              28   7.0  
SB_42630| Best HMM Match : Ets (HMM E-Value=0)                         28   9.2  
SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)                    28   9.2  
SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.2  

>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  199 bits (486), Expect = 2e-51
 Identities = 117/204 (57%), Positives = 134/204 (65%), Gaps = 5/204 (2%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVA
Sbjct: 1   MAKTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVA 60

Query: 252 MTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSR--LSVMEANLRSR*HIRVK--TKPFSP 419
           M P  + ++ +    +  K     P  +  ++     V+    R +  +  K   K F P
Sbjct: 61  MNP--ENTVFDAKRLIGRK--FDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFP 116

Query: 420 RKSVPWCXXXXXXXXXXIL-ANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEP 596
            +                L A   +      AYF+DSQRQATKDAGTI+GLNVLRIINEP
Sbjct: 117 EEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFHDSQRQATKDAGTIAGLNVLRIINEP 176

Query: 597 TAAAIAYGLDKKGTGERNVLIFDL 668
           TAAAIAYGLDKK   ERNVLI+DL
Sbjct: 177 TAAAIAYGLDKKVGVERNVLIYDL 200



 Score =  124 bits (300), Expect = 6e-29
 Identities = 54/75 (72%), Positives = 64/75 (85%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGRKF+D  V  DM HWPF V+ +G +PKI+V +KGE K+FFPEE+SS
Sbjct: 62  NPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISS 121

Query: 434 MVLTKMKETAEAYLG 478
           MVLTKMKETAEAYLG
Sbjct: 122 MVLTKMKETAEAYLG 136



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIEDGIFEVKSTAGDT
Sbjct: 202 GGTFDVSVLTIEDGIFEVKSTAGDT 226


>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  161 bits (392), Expect = 4e-40
 Identities = 99/203 (48%), Positives = 123/203 (60%), Gaps = 10/203 (4%)
 Frame = +3

Query: 90   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPTT 266
            +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+   P  
Sbjct: 704  IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNP-- 761

Query: 267  QYSMPNVSSDVSSKMLLCKPT*STGLSR------LSVMEANLRSR*HIRVK--TKPFSPR 422
                 N   D  +K L+ +    T +          V++ N +    ++VK   K F+  
Sbjct: 762  ----ENTVFD--AKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAE 815

Query: 423  KSVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPT 599
            +                L            AYFND+QRQATKDAG I+GL V+RIINEPT
Sbjct: 816  EISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPT 875

Query: 600  AAAIAYGLDKKGTGERNVLIFDL 668
            AAAIAYG+DKK  GE+N+L+FDL
Sbjct: 876  AAAIAYGMDKK-EGEKNILVFDL 897



 Score =  103 bits (248), Expect = 1e-22
 Identities = 48/76 (63%), Positives = 60/76 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+FDAKRLIGR ++D +VQ D+K +PF+VV    KP ++V  K E KTF  EE+S+
Sbjct: 760 NPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISA 819

Query: 434 MVLTKMKETAEAYLGK 481
           MVLTKMKETAEAYLGK
Sbjct: 820 MVLTKMKETAEAYLGK 835



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/25 (72%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV +T GDT
Sbjct: 899 GGTFDVSLLTIDNGVFEVVATNGDT 923


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  130 bits (313), Expect = 2e-30
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M KAPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVA
Sbjct: 1   MTKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  102 bits (245), Expect = 3e-22
 Identities = 57/100 (57%), Positives = 65/100 (65%), Gaps = 25/100 (25%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV-- 427
           +P NTIFDAKRLIGR+F+D  V+ DMKHW FEVV++ G+PK+KV YKGE KTFF EEV  
Sbjct: 62  NPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEVVN 121

Query: 428 -----------------------SSMVLTKMKETAEAYLG 478
                                  SSMVL KMKETAEAYLG
Sbjct: 122 EAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLG 161



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 49/53 (92%), Positives = 49/53 (92%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDL
Sbjct: 241 AYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDL 293



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/25 (88%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L+IEDGIFEVKST GDT
Sbjct: 295 GGTFDVSVLSIEDGIFEVKSTHGDT 319



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 422 EVSSMVLTKMKETAEAYLG 478
           ++SSMVL KMKETAEAYLG
Sbjct: 211 QISSMVLNKMKETAEAYLG 229



 Score = 35.5 bits (78), Expect = 0.046
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAG 554
           AYFNDSQRQATKDAG
Sbjct: 173 AYFNDSQRQATKDAG 187


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  125 bits (301), Expect = 4e-29
 Identities = 56/76 (73%), Positives = 67/76 (88%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIFDAKRLIGR+++DATVQ+DMK WPF+++SD  KPKI+V YKGE KTF  EE+SS
Sbjct: 62  NPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISS 121

Query: 434 MVLTKMKETAEAYLGK 481
           MVL KMKETAEAYLG+
Sbjct: 122 MVLGKMKETAEAYLGQ 137



 Score =  124 bits (300), Expect = 6e-29
 Identities = 56/63 (88%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M KAPA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA
Sbjct: 1   MGKAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score = 99.5 bits (237), Expect = 2e-21
 Identities = 46/53 (86%), Positives = 51/53 (96%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFNDSQRQATKDAGTI+GLNVLR+INEPTAAA+AYGLDK  +GE+NVLIFDL
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDL 200



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 1/26 (3%)
 Frame = +2

Query: 671 GGTFDVSILTIEDG-IFEVKSTAGDT 745
           GGTFDVSILTI+DG +FEVKSTAGDT
Sbjct: 202 GGTFDVSILTIDDGSLFEVKSTAGDT 227


>SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVSSMV 439
           NTI   KR IGRKF D  VQ ++ H P++VV        I+V Y G+ + F PE+V +M+
Sbjct: 121 NTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAML 180

Query: 440 LTKMKETAEAYL 475
            T++K TAE  L
Sbjct: 181 FTRLKTTAEIAL 192



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG D+G     + V + G +E +AN+  +R TPS+V+  D +RLIG + KNQ
Sbjct: 4   VGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQ 55



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG---TGERNVLI 659
           +C     +Y+ D QR+   DA   +GLN LR++N+ TA ++AYG+ K+       RNV+ 
Sbjct: 198 DCVISVPSYYTDRQRRCMLDASATAGLNCLRLMNDTTAVSLAYGIYKQDLPTDKPRNVVF 257

Query: 660 FDL 668
            D+
Sbjct: 258 VDI 260


>SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)
          Length = 437

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 28/63 (44%), Positives = 42/63 (66%), Gaps = 2/63 (3%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           K   +GIDLGTTYSCVG +Q   G+++I +++  ++  PS VAFTD   L+G+ A +Q  
Sbjct: 30  KPKIIGIDLGTTYSCVGAYQAISGRIDIFSDENDDKVVPSLVAFTDKGVLVGEKALSQAE 89

Query: 252 MTP 260
           + P
Sbjct: 90  INP 92



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 30/53 (56%), Positives = 39/53 (73%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           A F+  QR AT  A +++G+ VLR+INEPTAAA+AYGL KK  G  NV++ DL
Sbjct: 178 AEFDIKQRNATVKAASLAGITVLRVINEPTAAALAYGLHKK-EGVANVMVVDL 229



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 48/168 (28%), Positives = 70/168 (41%), Gaps = 5/168 (2%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEVS 430
           +P NTI+DAKR IG+ F    +    K + F V +D  G     V  KG      PEE+ 
Sbjct: 91  NPKNTIYDAKRFIGKTFTKQELLEIGKLYQFRVTTDKRGNAGFLVGKKGNFTVITPEEIG 150

Query: 431 SMVLTKMKETAEAYL----GKLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLERSPNHQ*TD 598
             V+ K++  AE  L     K      + F + Q  + T        + + R  N     
Sbjct: 151 GYVIKKLRTMAERNLTTTVTKAVMSVPAEFDIKQ-RNATVKAASLAGITVLRVINEPTAA 209

Query: 599 CCCDCLRS*QKGYWRTKCTYL*PRGGTFDVSILTIEDGIFEVKSTAGD 742
                L   ++G        L   GGT DVS+L I+ G+F   + AG+
Sbjct: 210 ALAYGLHK-KEGVANVMVVDL--GGGTLDVSLLNIQGGMFVTMAMAGN 254


>SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)
          Length = 179

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 40/73 (54%), Positives = 44/73 (60%), Gaps = 26/73 (35%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLN------------------------VLRIINEPTAAAIAY 617
           A+FND+QRQATKDAGTI+GL+                        VLRIINEPTAAAIAY
Sbjct: 47  AHFNDAQRQATKDAGTIAGLDVLSRTASERPPSRFRRRRPHGRSRVLRIINEPTAAAIAY 106

Query: 618 GLDKK--GTGERN 650
           GLDK   G  ERN
Sbjct: 107 GLDKARGGKAERN 119



 Score = 37.1 bits (82), Expect = 0.015
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +2

Query: 377 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGK 481
           I V   GE ++F PE++S++VL ++K  AEA+LG+
Sbjct: 2   IAVEVCGEKRSFAPEQISAVVLEQLKADAEAFLGQ 36


>SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/25 (72%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFD+SIL I+ G+FEVK+T GDT
Sbjct: 9   GGTFDISILEIQKGVFEVKATNGDT 33


>SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1019

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 4/58 (6%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLAA 674
           +FN ++R+A   A  + GLNVL+I+N  TA A+ YGL ++     T E++ + +D+ A
Sbjct: 115 FFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGA 172


>SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)
          Length = 592

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +3

Query: 141 GKVEIIANDQGNRTTPSYVAFTDTERLI 224
           G   IIAND G+R TP+ VAF+DTE+LI
Sbjct: 83  GNTTIIANDAGDRVTPAMVAFSDTEKLI 110


>SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 665

 Score = 31.5 bits (68), Expect = 0.75
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +2

Query: 59  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 235
           L++ N +  ++ + R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 225 LRLVNTRDDKTHDKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTETETRFCAKRCA 282

Query: 236 QEPGGDDPNNTIFDA 280
               G DP NT F+A
Sbjct: 283 GTASGMDPKNTPFNA 297


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 31.1 bits (67), Expect = 0.99
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query: 150 EIIANDQGNRTTPSYVAFT-DTERL 221
           ++I N +G+RTTPS VAFT + ERL
Sbjct: 7   KVIENAEGSRTTPSVVAFTPEGERL 31


>SB_7343| Best HMM Match : EGF (HMM E-Value=0)
          Length = 1233

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 18/72 (25%), Positives = 30/72 (41%)
 Frame = +3

Query: 111 TYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVS 290
           T++   +  H    I+ N  G  +TP     + T       A + + MTPT       V+
Sbjct: 559 THTTTSITLHPSSAILDNSLGPASTPRTTISSTTHVSSTPIASSSMVMTPTAINPSATVT 618

Query: 291 SDVSSKMLLCKP 326
           + V S  ++ KP
Sbjct: 619 TTVPSTSVVVKP 630


>SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3)
          Length = 350

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = -2

Query: 258 GSSPPGSWRHLR*DARCL*TQHKTEWSCCPGRW 160
           GS PPG W   R +AR   T  +T +SC PG W
Sbjct: 206 GSCPPGFWCRKRREARAA-TDLET-YSCPPGFW 236


>SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1066

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%)
 Frame = +2

Query: 59  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 235
           L++ N +  ++   R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 661 LRLVNTRDDKTHGKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTDTETRFCEKRCA 718

Query: 236 QEPGGDDPNNTIFDA 280
               G DP N  F+A
Sbjct: 719 GTASGMDPKNIPFNA 733


>SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 695

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +2

Query: 230 CRQEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWP 343
           C Q     D N TI   K L+ +  ED      ++HWP
Sbjct: 389 CLQICANSDGNLTITPVKTLVFKAAEDTKPSHHLRHWP 426


>SB_9053| Best HMM Match : TIG (HMM E-Value=0)
          Length = 2990

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 18   HVC*VVLRTSNKTD*KYKMAKAPAVGIDL 104
            HVC +V  T  K   K  ++K PA GI+L
Sbjct: 1200 HVCNIVSNTETKITCKLDVSKTPAPGIEL 1228


>SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1506

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = -2

Query: 465  SAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASSNLRPMR 286
            S   F+F ST  + +S +KV+ SPL  + +    P+     G    S C V   NL    
Sbjct: 1108 SPAKFVFTSTGIVRASTRKVVPSPLRRSKVPPTVPAQRLFNGDRVESICNV--QNLSRCP 1165

Query: 285  RLASNIVL 262
            ++++  VL
Sbjct: 1166 KISNATVL 1173


>SB_24762| Best HMM Match : Astacin (HMM E-Value=0)
          Length = 733

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = -2

Query: 552 LHLLWLVFESH*STRNRDNCILHSLPR*ASAVSFIFVSTMELTS 421
           ++ LWL F  + S+ + D C+LHS+   A+ +    VS  EL S
Sbjct: 415 IYTLWLDFSRYYSSASSDICVLHSIAHLANPLP---VSLNELLS 455


>SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3)
          Length = 549

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = -2

Query: 516 STRNRDNCILHSLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLIL--GLP 364
           S  N D+  +H   R +S+VS   V T  L+    K+L + +  TLI+  GLP
Sbjct: 108 SLNNSDSATVHK--RRSSSVSSHIVDTWRLSKDEAKILPTVIVGTLIIVFGLP 158


>SB_42630| Best HMM Match : Ets (HMM E-Value=0)
          Length = 631

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 42  IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 89


>SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)
          Length = 1774

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -3

Query: 659 DKYISFSSTLFVKTVSNRSSSRFIDDSEN 573
           +K ISF  +LF+  VSN S+ R+I  +E+
Sbjct: 752 NKVISFGPSLFMDKVSNASAGRYICIAES 780


>SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 977

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 388 IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 435


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,032,654
Number of Sequences: 59808
Number of extensions: 599146
Number of successful extensions: 2044
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1780
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2032
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2010148439
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -