Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30182.Seq
         (827 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_10458| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2.5)           28   8.0  

>SB_10458| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2.5)
          Length = 501

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 4/67 (5%)
 Frame = -2

Query: 409 PPRTLSRYFDVTHATAQ-LAPTFISKVNTAVQLLLVGTTLASPVFGYVDHPALK---SCV 242
           P R  S+ F  T   A+  AP   S+++ A  +   GT  A    G  DH ALK   S +
Sbjct: 423 PFRRQSKAFTPTEVHAEGAAPAPSSRMHAAHSMTAAGTASAPGPGGISDHTALKAGLSAL 482

Query: 241 ELLQPQL 221
            LL P +
Sbjct: 483 VLLVPMI 489


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,706,489
Number of Sequences: 59808
Number of extensions: 486896
Number of successful extensions: 941
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 941
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2323539746
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)