SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)                108   7e-24
SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.)              82   5e-16
SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0)                 79   5e-15
SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0)                 64   2e-10
SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06)           62   6e-10
SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0)                 61   1e-09
SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27)           61   1e-09
SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33)            57   2e-08
SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41)       55   7e-08
SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21)           42   7e-04
SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.)                41   0.001
SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0)                     38   0.014
SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)           36   0.033
SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19)                 36   0.044
SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2)               35   0.10 
SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19)           34   0.13 
SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07)           33   0.41 
SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.72 
SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05)            31   1.7  
SB_54605| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.9  
SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058)                   29   3.8  
SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32)         29   3.8  
SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32)         29   3.8  
SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_25359| Best HMM Match : p450 (HMM E-Value=0)                        29   5.1  
SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083)               29   5.1  
SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33)         29   5.1  
SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30)                   29   6.7  
SB_8819| Best HMM Match : I-set (HMM E-Value=0)                        29   6.7  

>SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 536

 Score =  108 bits (259), Expect = 7e-24
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432
           +S IKLAKVDAT E  L E + V+GYPT+KFF++G P +Y+GGR A +I+SWL KKTGPP
Sbjct: 74  KSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAPEIVSWLNKKTGPP 133

Query: 433 AVEVTSAEQAKELIDANTVIVFGFFWTRAQPEPKLSFQXXXXXXXXXXXXSAMRK*SRSW 612
           A ++ +A+  K+ I    V V GFF  +     K                 + +   +S 
Sbjct: 134 AKDLATADAMKDFI-TKEVAVVGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKLLPQST 192

Query: 613 RLKMKMLCFSRTS 651
           +L+   LCFSR++
Sbjct: 193 KLRETRLCFSRSA 205



 Score = 92.3 bits (219), Expect = 5e-19
 Identities = 39/73 (53%), Positives = 55/73 (75%)
 Frame = +2

Query: 35  MRVLIFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLA 214
           M++L    +AL+ LA  +E+  EE+VLVL++ NF+  +   +++LVEFYAPWCGHCK+LA
Sbjct: 1   MKLLPVLLLALVSLAYSEEIKEEEDVLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALA 60

Query: 215 PEYAKAATKLAEE 253
           PEYAKAA +L  E
Sbjct: 61  PEYAKAAGQLKSE 73



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +2

Query: 20  ADNIEMRVLIFTAIALLGLALGDEVPTE---ENVLVLSKANFETVITTTEY-ILVEFYAP 187
           ++N++  V  F    L    L  E+P +   + V VL   NF+ V    +  + VEFYAP
Sbjct: 353 SENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAP 412

Query: 188 WCGHCKSLAPEYAKAATK 241
           WCGHCK LAP + +   K
Sbjct: 413 WCGHCKQLAPIWDQLGEK 430



 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 4/64 (6%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF-RNGSPIDYSGGRQADDIISWLK---KKTGP 429
           I +AK+D+T  +   E   V  +PT+K+F + G  +DY+GGR  DD + +L+   K    
Sbjct: 437 IVVAKMDSTANE--VEGVKVHSFPTIKYFPKEGEAVDYNGGRTLDDFVKFLESGGKAGNE 494

Query: 430 PAVE 441
           PA E
Sbjct: 495 PAAE 498


>SB_48081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 645

 Score = 82.2 bits (194), Expect = 5e-16
 Identities = 37/57 (64%), Positives = 42/57 (73%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           DEV  E++V VL+  NF+ VI     ILVEFYAPWCGHCKSLAPEYAKAA K+   D
Sbjct: 55  DEVKEEDDVSVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLND 111



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 1/84 (1%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAV 438
           PI LA VDAT E +LA+ Y V+GYPTLK FR G   +Y G R    I S+++ + GP + 
Sbjct: 228 PIPLAIVDATIESELAQKYEVQGYPTLKVFRKGKATEYKGQRDQYGIASYMRSQVGPSSR 287

Query: 439 EVTSAEQAKELI-DANTVIVFGFF 507
            ++S +  ++ + + + V + GFF
Sbjct: 288 ILSSLKAVQDFMKEKDDVTIMGFF 311



 Score = 68.5 bits (160), Expect = 7e-12
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 6/89 (6%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG---- 426
           P+  AK+DAT   D+A+ + V GYPTLK FR G+P +Y G R+   I+ ++KK++     
Sbjct: 113 PVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWK 172

Query: 427 -PPAVEVT-SAEQAKELIDANTVIVFGFF 507
            PP   +T + E   E+++  ++++  FF
Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFF 201



 Score = 68.1 bits (159), Expect = 9e-12
 Identities = 29/54 (53%), Positives = 35/54 (64%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           P     L L+K NF  V+     +LVEF+APWCGHCK LAPEY KAA +L + D
Sbjct: 173 PPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKHD 226



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 3/72 (4%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNG---SPIDYSGGRQADDIISWLKKKTGPP 432
           I +AK+DAT   D+  +Y V G+PT+ F  +    +PI + GGR+  D+I ++++K    
Sbjct: 576 IVIAKIDATAN-DVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEK---- 630

Query: 433 AVEVTSAEQAKE 468
           A    S E+AK+
Sbjct: 631 ATVSLSKEKAKD 642



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +2

Query: 23  DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANFETVITTTEY-ILVEFYAPWC 193
           D++   V  F A  L  +     VP   +E V V+    F+ ++   +  +L+EFYAPWC
Sbjct: 496 DSLREFVEEFKAGNLKPIIKSQPVPKSNKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWC 555

Query: 194 GHCKSLAPEYAK 229
           G   +L P + K
Sbjct: 556 G--IALEPTFKK 565


>SB_35157| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 1056

 Score = 79.0 bits (186), Expect = 5e-15
 Identities = 41/85 (48%), Positives = 54/85 (63%), Gaps = 3/85 (3%)
 Frame = +1

Query: 259 PIKLAKVDATQE-QDLAESYGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTGPP 432
           P+ LAKVD T+  +D    YGV GYPTLK FRNG    DY G R +  II ++KK+ GP 
Sbjct: 590 PVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPS 649

Query: 433 AVEVTSAEQ-AKELIDANTVIVFGF 504
           +VE+ S +   K+L DA + +V GF
Sbjct: 650 SVEIKSVDHLEKKLDDAESNVVVGF 674



 Score = 62.1 bits (144), Expect = 6e-10
 Identities = 26/50 (52%), Positives = 35/50 (70%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +VL L  +NF++ +   + +LVEF+APWCGHCK LAPEY  AA  L + D
Sbjct: 539 DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKND 588



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 30/94 (31%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +2

Query: 110  VLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAATKLAE-EDLLSN*RKLT 283
            V V+   NF+ ++   T+ +L+EFYAPWCGHCKSL P+Y +   KL + +D++    K+ 
Sbjct: 864  VKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVI--AKMD 921

Query: 284  QLKNRISPRATVYEDTRLSNSSGMAVLSTIQVVV 385
               N   P  +V +   + +  G+ ++  I +++
Sbjct: 922  ATANDAPPNFSV-QGIIIISIIGIIIIVIIMIII 954



 Score = 31.9 bits (69), Expect = 0.72
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426
           +G+  +PTLK FR G P  DY+G +    + S++  + G
Sbjct: 448 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 486


>SB_46929| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 362

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 28/49 (57%), Positives = 39/49 (79%), Gaps = 1/49 (2%)
 Frame = +2

Query: 101 EENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           +E+V+ L+  NFE  V+ + +  LVEF+APWCGHC+ LAPE+AKAAT+L
Sbjct: 78  KEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATEL 126



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 10/94 (10%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNG-----SPIDYSGGRQADDIISWLKK 417
           +  +K+  +DAT     A  Y V+GYPT+K F  G     S  DY GGR A DII +   
Sbjct: 127 KGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALD 186

Query: 418 KTG-----PPAVEVTSAEQAKELIDANTVIVFGF 504
           K       P  ++  S E  KE  + + + V  F
Sbjct: 187 KAADSIEPPEVIQAISNEVLKEGCNEHPICVIAF 220



 Score = 35.9 bits (79), Expect = 0.044
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = +1

Query: 295 QDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDII 402
           Q +   Y +RG+PT+K F     SP DY+G R A  I+
Sbjct: 5   QSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIV 42


>SB_20276| Best HMM Match : Thioredoxin (HMM E-Value=9.8e-06)
          Length = 70

 Score = 62.1 bits (144), Expect = 6e-10
 Identities = 26/50 (52%), Positives = 35/50 (70%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +VL L  +NF++ +   + +LVEF+APWCGHCK LAPEY  AA  L + D
Sbjct: 14  DVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKND 63


>SB_30398| Best HMM Match : Thioredoxin (HMM E-Value=0)
          Length = 295

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           T+  V+ L+K NF+ V+   ++ LVEFYAPWCGHCK LAP Y
Sbjct: 20  TQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTY 61



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 26/59 (44%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           S + +AKVDA  ++DL   + V+G+PT+K+F  GS  P +Y+GGR  +D I ++++KTG
Sbjct: 72  SDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTG 130


>SB_17740| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-27)
          Length = 472

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLV-LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L   D VP +E  L+ L  +NFE  +   +++LV+FYAPWC HCK +AP+Y   A +L
Sbjct: 123 LMASDGVPDDEPTLLELDDSNFEPAVQKHKFVLVDFYAPWCFHCKKMAPDYKDVAKEL 180



 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +2

Query: 95  PTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           P    VL L+  NF   I   EY+LV+FYAPWC  C+ L+P +  AA +L + +
Sbjct: 48  PASPAVLNLNDQNFNETIKKNEYVLVDFYAPWCSDCQRLSPLFDTAALQLRDNN 101


>SB_3640| Best HMM Match : Thioredoxin (HMM E-Value=4.3e-33)
          Length = 386

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +2

Query: 86  DEVP---TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           DE P   T   V+ L    F+  +     +LV FYAPWCGHCK++ PEY  AA  L E++
Sbjct: 73  DEKPWSDTPSEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQE 132

Query: 257 L 259
           +
Sbjct: 133 I 133



 Score = 53.2 bits (122), Expect = 3e-07
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           E+P+E  V  LS   F++ +   +++LV FYAPWCGHCK   PE   AA
Sbjct: 192 EIPSE--VYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAA 238



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL-KKKTG 426
           RR  I  A VD T+E  + + +GV GY    F    +   Y+ GR+A D I ++   + G
Sbjct: 264 RRRLIAYAAVDCTKEMAVCQQFGVEGY----FNYGKNDFKYTSGREAKDFIQFMDDPREG 319

Query: 427 PP 432
           PP
Sbjct: 320 PP 321



 Score = 33.1 bits (72), Expect = 0.31
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           +++  Y   CG+CK   PE+A AAT+  +E
Sbjct: 2   VVIVLYIAGCGYCKRFKPEFAAAATEHKDE 31



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPT 336
           P  LA VDAT+E  L + + V GYPT
Sbjct: 134 PGVLAAVDATKEAALGKRFKVEGYPT 159


>SB_45978| Best HMM Match : Thioredoxin (HMM E-Value=4.19997e-41)
          Length = 271

 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = +2

Query: 101 EENVLV--LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E++ LV  L  ++F   +  TE++LV FYAPWCGHCK+  P+Y KAA    ++
Sbjct: 144 EDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKDQ 196



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 24/66 (36%), Positives = 35/66 (53%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           G    D    +  V+ L+  + +  I + E +LV ++APWCGHC  + P Y KAA  L +
Sbjct: 39  GYPTSDWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHD 98

Query: 251 EDLLSN 268
           ED   N
Sbjct: 99  EDANCN 104



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 271 AKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKKTGP 429
           AK+D T+  D+ +   V GYPTL+++  G   ++Y G R  +D+IS++++   P
Sbjct: 202 AKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFMEEPPLP 255



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWL 411
           LA VD T+ +D+A+   + GYPT+K ++  +    +   +   ++  L
Sbjct: 105 LAAVDCTKHKDVAKKVALAGYPTVKLYKASNTAKAASAEEDSSLVKQL 152


>SB_30496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 488

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/51 (43%), Positives = 32/51 (62%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           E  +  L+  +F+  +   E +LV+FYAPWC  C +L P+Y KAA  LA+E
Sbjct: 21  ENPIFELTDQDFDNFLKDKEVMLVDFYAPWCSDCDNLRPKYEKAARDLAKE 71


>SB_30498| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 564

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDL 259
           L+  NF+ +I   + +LV+FYAPWC HC+ L P+   AA  LA + L
Sbjct: 25  LNAQNFDQMIREKDIMLVDFYAPWCHHCQELLPQLEGAANALAAKGL 71


>SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 711

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V SK  F  V+ + +  +V+FYAPWCG C   AP+Y + A  L
Sbjct: 438 VNSKNFFTDVLASEDAWVVDFYAPWCGPCMRFAPKYEQLAKML 480



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +2

Query: 74  LALGDEVPTEENVLVLSKANFETVITT-TEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +AL  +     NV  L   +F + +T+ +    V+F+APWC  C  L PEY KAA
Sbjct: 274 IALFAKESVSSNVHALGPEDFPSSVTSPSRPFFVDFFAPWCPPCMRLLPEYRKAA 328



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +1

Query: 259 PIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLK 414
           P+    VD T    L   Y +R YPT   + N  P  + G   A DII +++
Sbjct: 335 PVGFGTVDCTVHSQLCHQYNIRSYPTTILYNNSQPHQFIGHHNALDIIEFVE 386


>SB_55398| Best HMM Match : Thioredoxin (HMM E-Value=3.6e-21)
          Length = 186

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           + +AKVD T + +L     +R YPT+K + +G    Y+G R A+D+  ++ K
Sbjct: 19  LTIAKVDCTSDVNLCVKQNIRAYPTMKLYYDGDIKRYTGRRNAEDMKVFVDK 70



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 98  TEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           +E  V +L+K  F+  I    +  V+FYAPWC HC  LAP + + A
Sbjct: 88  SEAGVHILTKNTFDKHIELGLHF-VKFYAPWCIHCIKLAPIWERLA 132



 Score = 29.5 bits (63), Expect = 3.8
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 319 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 411
           + GYPTL  F++G    +YSG R  D +  ++
Sbjct: 146 INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 177


>SB_218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = +2

Query: 125 KANFETVITTTE--YILVEFYAPWCGHCKSLAPEYAKAA 235
           +A F +VI  T+   ++++FYA WCG C+ + P++ K A
Sbjct: 18  RAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMA 56


>SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0)
          Length = 308

 Score = 37.5 bits (83), Expect = 0.014
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +2

Query: 107 NVLVLS-KANFETVITT--TEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           NV VL   + F   +T   T+ ++ +F A WCG CKS+AP Y+  + K
Sbjct: 8   NVKVLELDSQFTAELTNAGTKLVVADFTASWCGPCKSIAPVYSGLSEK 55



 Score = 32.3 bits (70), Expect = 0.54
 Identities = 17/51 (33%), Positives = 24/51 (47%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           K+D    Q+LA   GV   PT +FF+N   +D   G     +   +KK  G
Sbjct: 63  KIDVDVCQELAAKQGVTAMPTFQFFKNKVKVDEVRGADPKALEDAIKKWIG 113


>SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)
          Length = 456

 Score = 36.3 bits (80), Expect = 0.033
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +2

Query: 107 NVLVLSKANFETVITT---TEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           NV+V+   +F +V      +  ++++F A WCG CKS+AP +   + K  +
Sbjct: 9   NVIVVEDDSFFSVEIERAGSRLVVIDFTATWCGPCKSIAPVFTNLSMKFMD 59



 Score = 33.5 bits (73), Expect = 0.23
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           KVD  Q Q  AES G+R  PT  F+ N + ID
Sbjct: 64  KVDVDQCQLTAESCGIRAMPTFHFYHNKAKID 95


>SB_38445| Best HMM Match : ERp29 (HMM E-Value=2.2e-19)
          Length = 335

 Score = 35.9 bits (79), Expect = 0.044
 Identities = 11/51 (21%), Positives = 28/51 (54%)
 Frame = +2

Query: 104 ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           + ++  +  N +  +  ++++ + FYAPW  HC+ +   + + A + A+ D
Sbjct: 26  KKIVEFTNENVDEYVDGSKFVFIFFYAPWDDHCQRILQIFDQVADEFADRD 76


>SB_31331| Best HMM Match : Thioredoxin (HMM E-Value=1.2)
          Length = 214

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 20/82 (24%), Positives = 38/82 (46%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + +A V+  +E +LA+  GV+    +  F  G  ++Y  G   +   + + +   PP   
Sbjct: 104 VTVAAVNVAEEYELAQKLGVKFSGAISVFHRGKRVEYY-GHSCNLTNNVVFQMFDPPVTN 162

Query: 442 VTSAEQAKELIDANTVIVFGFF 507
           + + +Q   L DA    V G+F
Sbjct: 163 IDNKKQRTLLEDAEGTKVVGYF 184


>SB_49513| Best HMM Match : Thioredoxin (HMM E-Value=1.8e-19)
          Length = 975

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCKSLAP 217
           + VI   + +L+ FY PWCG C + AP
Sbjct: 529 DIVINNDQDVLLVFYTPWCGMCINFAP 555


>SB_44457| Best HMM Match : Thioredoxin (HMM E-Value=2.2e-07)
          Length = 438

 Score = 32.7 bits (71), Expect = 0.41
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
 Frame = +2

Query: 134 FETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA-----TKLAEEDLLSN*RKLTQLKNR 298
           F+  +   E   ++F A WCG C+ + P++ + A      K A+ D+  N  ++ ++ NR
Sbjct: 4   FDKFLKDNEVAAIDFTATWCGPCRMIGPKFEEMAKEFKGVKCAKVDVDVNSVEVLRVDNR 63


>SB_59094| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 335

 Score = 31.9 bits (69), Expect = 0.72
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPI-DYSGGRQADDIISWLKKKTG 426
           +G+  +PTLK FR G P  DY+G +    + S++  + G
Sbjct: 251 FGIHQWPTLKLFRYGQPWGDYTGPQDTASLESYIHDQLG 289


>SB_2701| Best HMM Match : Thioredoxin (HMM E-Value=4.8e-05)
          Length = 215

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 131 NFETVITTTEYIL--VEFYAPWCGHCKSLAPEYAKAATKLAEEDLLSN*RKLTQLKNRIS 304
           +F+ +++++  +L  V F+APW  HC  +     + A +    + + N + + ++    +
Sbjct: 11  DFDRILSSSSNVLAVVHFFAPWAPHCNQMNDVLEELAKENPHVNFIKNQKVVDRIDGANA 70

Query: 305 PRAT 316
           P  T
Sbjct: 71  PELT 74


>SB_54605| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 911

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 25/84 (29%), Positives = 44/84 (52%), Gaps = 9/84 (10%)
 Frame = -2

Query: 540 GKFWLWLSSGPK----ETKYNNSIGIDK--FFS---LFSRGDLNSRGASLLLQPTDDVIS 388
           GKF+L +   P     ET Y+N+IGI +  +++   +FS+  L S G S+L    DD+ S
Sbjct: 234 GKFYLRIVVNPNRTVAETDYDNNIGICEVDYYNPVVIFSKCRLVSTGQSILPVLPDDLSS 293

Query: 387 LTTT*IVDRTAIPEEFESRVSSYT 316
            T + +  +       +  ++SY+
Sbjct: 294 RTDSGVRQQETTRAIIKGDIASYS 317


>SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058)
          Length = 664

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +2

Query: 170 VEFYAPWCGHCKSLAPEYAKAATKL 244
           V FYAPWCG  +    E+  AA+ L
Sbjct: 457 VFFYAPWCGQSRRAVEEFNIAASLL 481


>SB_18397| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32)
          Length = 1626

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +1

Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFWTR 516
           L+F +  S I  SGG Q   +  W        A E TSAE+A   +D   V + G  W +
Sbjct: 793 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERANRAVDRPPVKILGIPWDK 847

Query: 517 AQPEPKLSF 543
            + E  ++F
Sbjct: 848 NKDELTIAF 856


>SB_13271| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 39

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 107 NVLVLSKANFETVITTTEYILVEFYA 184
           NV++L + NF+ VI   + + V FYA
Sbjct: 12  NVVILDEGNFDKVIAENKLVFVNFYA 37


>SB_35488| Best HMM Match : Peptidase_A17 (HMM E-Value=8.1e-32)
          Length = 1019

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +1

Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFWTR 516
           L+F +  S I  SGG Q   +  W        A E TSAE+A   +D   V + G  W +
Sbjct: 472 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERANRAVDRPPVKILGIPWDK 526

Query: 517 AQPEPKLSF 543
            + E  ++F
Sbjct: 527 NKDELTIAF 535


>SB_25332| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 41

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +1

Query: 319 VRGYPTLKFFRNG-SPIDYSGGRQADDIISWL 411
           + GYPTL  F++G    +YSG R  D +  ++
Sbjct: 1   INGYPTLMLFKDGVQKKEYSGNRDLDSLYRFI 32


>SB_25359| Best HMM Match : p450 (HMM E-Value=0)
          Length = 1084

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +1

Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFWTR 516
           L+F +  S I  SGG Q   +  W        A E TSAE+A   +D   V + G  W +
Sbjct: 180 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERADRAVDRPPVKILGIPWDK 234

Query: 517 AQPEPKLSF 543
            + E  ++F
Sbjct: 235 NKDELTIAF 243


>SB_12095| Best HMM Match : Vicilin_N (HMM E-Value=0.083)
          Length = 501

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 3/85 (3%)
 Frame = +3

Query: 474 RCQYCYCIWFLL---DQSSARAKTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFK 644
           +C   +C+  ++   DQ         + AQVV   + +   D   + E + ++E+  + +
Sbjct: 169 QCVVAHCVQCMIAHGDQCVVAHCVQCTIAQVVKRSIESAKKDASKVLERQRKEEEAQVLR 228

Query: 645 NFEEKRVKYXDEEITEDLLNALGVV 719
            F EK  K   E +  D LN L  +
Sbjct: 229 RFREK--KEDTETLVNDELNELSTM 251


>SB_11559| Best HMM Match : Peptidase_A17 (HMM E-Value=3.8e-33)
          Length = 1485

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +1

Query: 337 LKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQAKELIDANTVIVFGFFWTR 516
           L+F +  S I  SGG Q   +  W        A E TSAE+A   +D   V + G  W +
Sbjct: 706 LRFKQEASEIMESGGFQ---LHKWHSNVL--EAEESTSAERADRAVDRPPVKILGIPWDK 760

Query: 517 AQPEPKLSF 543
            + E  ++F
Sbjct: 761 NKDELTIAF 769


>SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30)
          Length = 739

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 582 VSDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEEITEDLLN 704
           +SDE++ K +   DE+  L K+  E+ +KY      ++LLN
Sbjct: 437 LSDEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLN 477


>SB_8819| Best HMM Match : I-set (HMM E-Value=0)
          Length = 1789

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%)
 Frame = +1

Query: 265  KLAKVDATQEQDLAESYGVRGYP--TLKFFRNGSPI 366
            KL  V  T+E D   +  V G P  T+K+F++G P+
Sbjct: 1042 KLQPVQVTEEDDCKLTCKVSGLPEPTIKWFKDGEPV 1077


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,810,516
Number of Sequences: 59808
Number of extensions: 516935
Number of successful extensions: 1297
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1168
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1291
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2550281014
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -