SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49434| Best HMM Match : CBFD_NFYB_HMF (HMM E-Value=3.6e-08)         38   0.008
SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.9  
SB_48682| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.9  
SB_45472| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-06)                 29   3.9  
SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.9  
SB_49885| Best HMM Match : Phi-29_GP4 (HMM E-Value=3.4)                29   5.1  
SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38)                 29   6.7  

>SB_49434| Best HMM Match : CBFD_NFYB_HMF (HMM E-Value=3.6e-08)
          Length = 120

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 20/57 (35%), Positives = 32/57 (56%)
 Frame = +1

Query: 346 EDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           E  K   LPL++IK I+K   ++  IS E+  L A++ E+F++ L + A    E  K
Sbjct: 9   ESGKLTQLPLSKIKTILKSSPDLANISQESLFLIARSTEVFVNYLAVAALKKEESKK 65


>SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 764

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -2

Query: 563 PISIYCRYVVALQSPPFISSVCDQAR 486
           P+S+YC Y+  LQ+     ++CD AR
Sbjct: 82  PLSVYCIYITNLQNTGEFHNLCDIAR 107


>SB_48682| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +3

Query: 447 REGC*DFYTRANVASLVAYGGNKRRTLQRNDIATVY 554
           R GC + Y R N   L     NK + L R  IA+VY
Sbjct: 57  RYGCPNIYRRVNTEGLTHRTINKEKVLPRYHIASVY 92


>SB_45472| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-06)
          Length = 230

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = -2

Query: 563 PISIYCRYVVALQSPPFISSVCDQAR 486
           P+S+YC Y+  LQ+     ++CD AR
Sbjct: 82  PLSVYCIYITNLQNTGEFHNLCDIAR 107


>SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 987

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 7/73 (9%)
 Frame = -2

Query: 377 ANGKAWVLKSSELT----FCMSSKTLSQNC-WRVCAPPQRRTPHRQISVHFFGRGNRRCL 213
           A+ +A VL+   LT    F   +++LS+ C W + A  +   P R    HF     RR L
Sbjct: 359 AHYRAHVLRRYPLTTAHMFPCVTRSLSRTCYWALYAHYRAHVPRRYSLTHFRAHVPRRYL 418

Query: 212 FGRHKEAH--GHF 180
           F  H  AH  GH+
Sbjct: 419 F-THFRAHVPGHY 430


>SB_49885| Best HMM Match : Phi-29_GP4 (HMM E-Value=3.4)
          Length = 307

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 15/53 (28%), Positives = 28/53 (52%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLF 447
           ++LQ  W++   D +KVN    +  AL     +++M  +  ++ I +E P LF
Sbjct: 197 ESLQNEWERRTPDFKKVN----RRMALTFPDRRRLMNSNPNIRDIQSEYPALF 245


>SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38)
          Length = 2084

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +1

Query: 310  DKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
            D  L DIQ   +E  K ++  L ++KK+ K ++E K +     VL  + A++
Sbjct: 977  DSKLNDIQSKFTETEKEKSQLLDKVKKLEKSEKEFKQLEYNITVLQNQLADM 1028


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,247,291
Number of Sequences: 59808
Number of extensions: 454833
Number of successful extensions: 1184
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1075
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1183
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2574115416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -