SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45627| Best HMM Match : AAA (HMM E-Value=0)                        126   2e-29
SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.18 
SB_38771| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.2  
SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                28   8.8  

>SB_45627| Best HMM Match : AAA (HMM E-Value=0)
          Length = 628

 Score =  126 bits (304), Expect = 2e-29
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMRAVEFKV+ETDPSP+CIVAPDTVIHC+GEP+KREEEEE+LN VGYDDIGGCRKQL
Sbjct: 108 VRGGMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEVGYDDIGGCRKQL 167



 Score =  101 bits (241), Expect = 1e-21
 Identities = 46/59 (77%), Positives = 56/59 (94%)
 Frame = +2

Query: 80  DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETV 256
           D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TV
Sbjct: 5   DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTV 63



 Score = 31.9 bits (69), Expect = 0.71
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVV 351
           L +G+  +   CIVLSDD   D+KIRM             DVV
Sbjct: 53  LIKGKKRKDTVCIVLSDDTISDDKIRMNRVVRMNLRVRLGDVV 95


>SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 802

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query: 697 IKEMVELPLRSS--FTVSRLLE*KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLIN 870
           ++EM+E+PL +   FT   +     PRGIL ++G   TGK T     +  ETG   F IN
Sbjct: 268 VREMIEMPLTNPELFTAYGVPP---PRGIL-LYGPSGTGK-TMIARAVANETGVHFFCIN 322

Query: 871 GPGIMS 888
           GP ++S
Sbjct: 323 GPEVLS 328


>SB_38771| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 267

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -2

Query: 860 KEEAPVSISNSTSQ*VFFPVTRRPHTWRMPRGSFHSNSLETVKDDRSGNSTISLICAQLF 681
           ++E PVSIS+   + +      +  TW++ RG F    ++ +K   + +  I  +  + F
Sbjct: 46  QQELPVSISSREEKYLTKDELTKLMTWKLSRGKFRPRLVDLIKS--NSDDKIDTLTKKAF 103

Query: 680 ATTADVIIA 654
               DVI A
Sbjct: 104 KLLPDVIQA 112


>SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 7381

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = -2

Query: 716  NSTISLICAQLFATTADVIIADSI*CFLFFLTFNRFTVTVY 594
            NS ++L+        AD+    S  CF+F   F+RFTV  Y
Sbjct: 5868 NSLVTLLAESQQRFAADIAFTRS--CFVFQGNFDRFTVVAY 5906


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,279,641
Number of Sequences: 59808
Number of extensions: 630611
Number of successful extensions: 1579
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1579
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2538363813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -