SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38)                   33   0.21 
SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_24093| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-13)                 29   3.5  
SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.6  
SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)                       29   6.1  
SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.1  
SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.0  

>SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = +1

Query: 373 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 465
           +G EA+ VTGP GEPV+GS YA D+RR  +R
Sbjct: 13  QGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 43


>SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38)
          Length = 80

 Score = 33.5 bits (73), Expect = 0.21
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = +2

Query: 185 IAEKVSGTVKWFNVKSGYGFI 247
           ++ + +GTVKWFN + GYGFI
Sbjct: 12  MSNRQNGTVKWFNDEKGYGFI 32



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +1

Query: 265 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 396
           +D+FVH  AI  +      +S+ +G+AV F    G+KG +A  V
Sbjct: 38  DDLFVHFKAIQSDG----FKSLKEGQAVTFVATRGQKGMQAEEV 77


>SB_18720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = +1

Query: 610 FFPSQFSRWTPWGXSW 657
           +FPS F+ W+PW  +W
Sbjct: 3   WFPSSFNSWSPWTWNW 18


>SB_24093| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-13)
          Length = 305

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 23/107 (21%), Positives = 45/107 (42%)
 Frame = -3

Query: 540 VHDVLILLCVDSFTASSATLTREILAVVATALVCSIR*AFYWLTTGTSNTSCFKAFLPGN 361
           +HD   +  + SF   S+ L+   LA V+   + ++   FY   TG +    F   L G 
Sbjct: 90  IHDAFYIFVLPSFAVFSSFLSVNFLAAVSVERLVAVTFPFYHRVTGKT----FYGLLIGT 145

Query: 360 HGKLHRLSVADRAHSLTWVVTGDGSLMHKHIFLGVILLMKPYPLLTL 220
              L  +S        T V+    +    ++FL ++++   Y ++ +
Sbjct: 146 PWLLAGISTVTTVCLPTPVIDISITFFVIYVFLPLLIMSAAYTVIMI 192


>SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 559

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = +1

Query: 295 ARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG-EPVKGSPYAADKRRG 456
           AR    +AVR    GE    +V  G  G    G  G GG E V+G+PY  ++  G
Sbjct: 395 AREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEG 449


>SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)
          Length = 768

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = -1

Query: 746 ILAXSLNFVLPAPAGNCADALXGTLLYSLGQDXPHGVHRENCDGKNALRW 597
           +L  SL   L  P+      L G+  +S  +D    +HRE C G ++L W
Sbjct: 149 VLLLSLWMALHPPSRKVI-VLEGSRKFSKDRDHEFVMHREECTGPHSLPW 197


>SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = +3

Query: 414 ASKRLTLCCRQAPWLPP 464
           AS   T+C RQAPWL P
Sbjct: 19  ASPTWTICLRQAPWLSP 35


>SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 416

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
 Frame = +2

Query: 425 AHLMLQTSAVATTANISLV-KVADEAVKESTQRRIRTSWTPA 547
           AH M   SA  TTA  S + +  D  ++E+T+R     W  A
Sbjct: 52  AHSMATRSATQTTAETSFITEEVDAVIQENTERVQELQWVVA 93


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,088,848
Number of Sequences: 59808
Number of extensions: 332029
Number of successful extensions: 970
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 969
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2311562737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -