SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48)                  41   4e-04
SB_52042| Best HMM Match : Pico_P2B (HMM E-Value=7.2)                  27   7.7  
SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.7  

>SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 849

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = +2

Query: 53  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR 166
           M K   ++KG+SAINEVVTREYT+NLHKR+HG+    R
Sbjct: 769 MVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYR 806



 Score = 52.0 bits (119), Expect = 2e-07
 Identities = 23/48 (47%), Positives = 32/48 (66%)
 Frame = +1

Query: 277 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTENVDASQ 420
           NVP+          N+DEDS HKL+TLVT V V++ KGLQT+ V++ +
Sbjct: 802 NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKGLQTQKVESEE 849


>SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48)
          Length = 776

 Score = 41.1 bits (92), Expect = 4e-04
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = +1

Query: 277 NVPFXXXXXXXXXXNDDEDSAHKLFTLVTYVPVASIKGLQTE 402
           NVP+          N+DEDS HKL+TLVT V V++ K L  E
Sbjct: 2   NVPYRVRVRLARKRNEDEDSPHKLYTLVTSVAVSTFKVLADE 43


>SB_52042| Best HMM Match : Pico_P2B (HMM E-Value=7.2)
          Length = 186

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 209 QMGTPDIRVDTRLNKSFGLRESEMFPSVSV*GFHE 313
           ++G PD+ +D   +K+FGL   E   S    GFHE
Sbjct: 30  RLGLPDLPMDPA-SKTFGLSSLEELQSPEDEGFHE 63


>SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +2

Query: 77  KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRK 196
           K K  INEV+T  Y     + L      KR  R IKE+ +
Sbjct: 213 KNKPEINEVITPRYPPGEGEVLDDASIIKRYKRQIKELEE 252


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,836,317
Number of Sequences: 59808
Number of extensions: 244438
Number of successful extensions: 434
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 415
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 433
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 957531822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -