SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95)                59   5e-09
SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.41 
SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.94 
SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.6  
SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06)                 30   2.2  
SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.9  
SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1)                 30   2.9  
SB_12568| Best HMM Match : Na_Ca_ex (HMM E-Value=0.0018)               29   5.0  
SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17)                   28   8.8  

>SB_55851| Best HMM Match : Hydrolase (HMM E-Value=0.95)
          Length = 209

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 24/45 (53%), Positives = 34/45 (75%)
 Frame = +1

Query: 229 RDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEV 363
           R +  ++   ++++AD VCFDVDSTV+  E IDELA FCG+G+EV
Sbjct: 2   RQMTESETRVIWKSADAVCFDVDSTVVTGEAIDELASFCGRGEEV 46



 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +3

Query: 522 LHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFN 650
           L   G  VYLVSGGF+S++EP+A+ L IP  N+FAN++ F  N
Sbjct: 62  LLSHGTQVYLVSGGFQSILEPIAKDLGIPKTNVFANKILFNSN 104


>SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4856

 Score = 32.7 bits (71), Expect = 0.41
 Identities = 18/39 (46%), Positives = 20/39 (51%)
 Frame = -1

Query: 861  LSLXSSXNQGXPPKPMKPSAGGXKPRASVAPVPGRSPGA 745
            LSL SS     PP P+KP +        VAP PG SP A
Sbjct: 4571 LSLDSSPPTKRPPPPVKPKSIKKTSPKEVAPKPGGSPHA 4609


>SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 266

 Score = 31.5 bits (68), Expect = 0.94
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = -2

Query: 383 ASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRAS 204
           +S+ S  +SS    + +SSS  +S  +  S+S  + S+  NNS  S  ++S  S+   +S
Sbjct: 196 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSNNSSSSSSSSSSSSSSSSSS 255

Query: 203 STSRTAGCFS 174
           S+S ++   S
Sbjct: 256 SSSSSSSSSS 265


>SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1067

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 2/118 (1%)
 Frame = -2

Query: 509  PVIPGVSLTGNFSMNSLI*PTLGLMMS-SLFFKASWNVILPPIASAVSLLTSS-PFPQNL 336
            PV+P  +     SM S    T     + SL    + N     +A AV++ +   P   ++
Sbjct: 877  PVLPTTTSVLTSSMESSSMATTSTSSTPSLESSMTTNSTTSTLAEAVAISSLVLPTTTSV 936

Query: 335  ASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTSRTAGCFSNCKE 162
             +SSM SS M   STS  T S   + +  S  +T   + P+ +S +S T    ++  E
Sbjct: 937  LTSSMESSSMATTSTS-STPSFESSMTTNSTTSTPAEAVPISSSVSSTTTSVLTSSME 993


>SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06)
          Length = 863

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = -2

Query: 398 ILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*ST 219
           + PP +S+    +SSP P + +SSS  SS  +  S+S  + S+  ++S  S  ++S    
Sbjct: 570 VSPPSSSS----SSSPPPASSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS---- 621

Query: 218 PVRASSTSRTAGCFS 174
              +SS+S + G FS
Sbjct: 622 --SSSSSSASLGYFS 634


>SB_40415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1512

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 4/82 (4%)
 Frame = -2

Query: 389  PIASAVSLLTSSPFP-QNLASSSMPSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPV 213
            P+A + SL +SS +  + LAS S   SC +VE+ S + +    N+  +S       S P+
Sbjct: 886  PLAPSTSLTSSSAYSTEGLASGSESGSCPSVEA-SAEAKDCDNNSYSESDSPRREYSDPM 944

Query: 212  RA---SSTSRTAGCFSNCKEPS 156
            R    SS   ++   S+   PS
Sbjct: 945  RGYPNSSIDNSSEADSSLGSPS 966


>SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1)
          Length = 305

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSP 751
           PP P+ P+ GG  P   +AP  G  P
Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPP 165


>SB_12568| Best HMM Match : Na_Ca_ex (HMM E-Value=0.0018)
          Length = 349

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 13/22 (59%), Positives = 15/22 (68%)
 Frame = -3

Query: 253 DSLLGRHHADRHQ*ERLQRRVL 188
           DS      ADRH+ ER+QRRVL
Sbjct: 55  DSKAAERRADRHRQERIQRRVL 76


>SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17)
          Length = 441

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = -1

Query: 321 AFILYDGRVYIEANAVRCPEQLRTVCWGDITLIDTSESVFNVAYCR 184
           A ++  G  Y+   A   PEQ  T CW    LI  S+ +    YCR
Sbjct: 110 ANVVLRGPTYLRKTASALPEQTATACW---RLIHLSQCI-ETHYCR 151


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,554,214
Number of Sequences: 59808
Number of extensions: 528898
Number of successful extensions: 1610
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1458
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1603
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2538363813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -