SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37396| Best HMM Match : PEPCK (HMM E-Value=0)                      144   7e-35
SB_3810| Best HMM Match : PEPCK (HMM E-Value=0)                       141   6e-34
SB_37397| Best HMM Match : PEPCK (HMM E-Value=0)                      135   4e-32
SB_50513| Best HMM Match : Lig_chan (HMM E-Value=0.0083)               29   6.8  
SB_15741| Best HMM Match : MANEC (HMM E-Value=2.7)                     28   9.0  

>SB_37396| Best HMM Match : PEPCK (HMM E-Value=0)
          Length = 549

 Score =  144 bits (350), Expect = 7e-35
 Identities = 76/128 (59%), Positives = 86/128 (67%), Gaps = 5/128 (3%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGGTPG-----WPCDPKNTIILHKPAENEIVXXXXXXXX 413
           S VL+ L  D  FVRCLH+VG     G     WPCDP+ T+I H P   EI         
Sbjct: 40  SHVLKALG-DGDFVRCLHSVGGPLHDGKNNVPWPCDPERTLITHFPETREIKSYGSGYGG 98

Query: 414 XXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMT 593
                KKCFALR+ SVIAR EGWLAEHM+I+G+TNP+GKK YIAAAFPSACGKTNLAM+T
Sbjct: 99  NSLLGKKCFALRIASVIARDEGWLAEHMMILGLTNPEGKKIYIAAAFPSACGKTNLAMLT 158

Query: 594 PNTGPGTK 617
           P T PG K
Sbjct: 159 P-TIPGWK 165



 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 30/40 (75%), Positives = 37/40 (92%)
 Frame = +1

Query: 133 MYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           MYV+PFSMGPVGSP+SKIG+E+TDS YVV  MR+MTR+G+
Sbjct: 1   MYVMPFSMGPVGSPISKIGIELTDSEYVVCCMRIMTRMGS 40



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+K  CVGDDIA M F  +    R  +  + GFFG
Sbjct: 162 PGWKCECVGDDIAWMWF-DKDGTLRA-INPECGFFG 195


>SB_3810| Best HMM Match : PEPCK (HMM E-Value=0)
          Length = 707

 Score =  141 bits (342), Expect = 6e-34
 Identities = 74/128 (57%), Positives = 86/128 (67%), Gaps = 5/128 (3%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGGTPG-----WPCDPKNTIILHKPAENEIVXXXXXXXX 413
           S VL+ L Q + FV+CLH+VG     G     WPCDP  TII H PA+N I         
Sbjct: 354 SHVLKALDQGD-FVKCLHSVGKPLKEGEKDVLWPCDPDRTIITHFPADNYIKSFGSGYGG 412

Query: 414 XXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMT 593
                KKCFALR+ S IA +EGWLAEHMLI+ +TNP+GKK+YIAAAFPSACGKTNLAM+ 
Sbjct: 413 NSLLGKKCFALRIASNIALKEGWLAEHMLIMALTNPEGKKKYIAAAFPSACGKTNLAMLK 472

Query: 594 PNTGPGTK 617
           P T PG K
Sbjct: 473 P-TIPGWK 479



 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 22/34 (64%), Positives = 31/34 (91%)
 Frame = +1

Query: 151 SMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           +MGPVGSP++KIG+++TDS YVV  MR+MTR+G+
Sbjct: 321 NMGPVGSPIAKIGIQLTDSEYVVCCMRIMTRMGS 354



 Score = 36.7 bits (81), Expect = 0.026
 Identities = 19/36 (52%), Positives = 24/36 (66%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFG 712
           PG+KV CVGDDIA M F  +T   R  +  ++GFFG
Sbjct: 476 PGWKVDCVGDDIAWMWF-DKTGQLRA-INPESGFFG 509


>SB_37397| Best HMM Match : PEPCK (HMM E-Value=0)
          Length = 613

 Score =  135 bits (327), Expect = 4e-32
 Identities = 73/128 (57%), Positives = 84/128 (65%), Gaps = 5/128 (3%)
 Frame = +3

Query: 249 SEVLEILRQDEQFVRCLHAVGSGGTPG-----WPCDPKNTIILHKPAENEIVXXXXXXXX 413
           S VL+ L  D  FVR +H+VG     G     WPCDP+ T+I H PA  EI         
Sbjct: 170 SHVLKALG-DGDFVRGVHSVGFPLKEGVKEVPWPCDPERTLITHFPATREIKSYGSGYGG 228

Query: 414 XXXXXKKCFALRLGSVIARREGWLAEHMLIVGITNPQGKKRYIAAAFPSACGKTNLAMMT 593
                KKCFALR+ S IA  EGWLAEHM+I+G+TNP+GKK YIAAAFPSACGKTNLAM+T
Sbjct: 229 NSLLGKKCFALRIASNIAHDEGWLAEHMMIMGLTNPEGKKIYIAAAFPSACGKTNLAMLT 288

Query: 594 PNTGPGTK 617
           P T PG K
Sbjct: 289 P-TIPGWK 295



 Score = 76.6 bits (180), Expect = 3e-14
 Identities = 32/43 (74%), Positives = 40/43 (93%)
 Frame = +1

Query: 124 GRTMYVIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGA 252
           GRTMYV+PFSMGPVGSP+SKIG+++TDS YVV  MR+MTR+G+
Sbjct: 128 GRTMYVLPFSMGPVGSPISKIGIQLTDSEYVVCCMRIMTRMGS 170



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = +2

Query: 605 PGYKVXCVGDDIALMKFRXRTAYFRGHLXRKNGFFGSC 718
           PG+K  CVGDDI  M F  +    R  +  ++GFFG C
Sbjct: 292 PGWKCECVGDDINWMWF-DKDGTLRA-INPESGFFGVC 327


>SB_50513| Best HMM Match : Lig_chan (HMM E-Value=0.0083)
          Length = 417

 Score = 28.7 bits (61), Expect = 6.8
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +2

Query: 386 RKLRQWIRRQ*FVGQEVLRSTSGISDRSSRRMAGRTYAYRRHNQ 517
           R L +WI+R+    + V +  + +SD SSRR   +T +  R+++
Sbjct: 226 RDLNKWIKREYHYTKTVDKVVTQLSDASSRRRESKTRSPDRYSR 269


>SB_15741| Best HMM Match : MANEC (HMM E-Value=2.7)
          Length = 263

 Score = 28.3 bits (60), Expect = 9.0
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 2/72 (2%)
 Frame = -2

Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELRSNSSHDSHRIN-HVRRIRDFY-ADLRERR 169
           GRRA+PE +   L +   R         E  +++S +  R+N   R  R    +++ +  
Sbjct: 127 GRRADPESNTDNLTKTKRRKRLFGGNQTEPVTDASLNEKRLNERFREHRSVIDSNVEDSA 186

Query: 168 SHRTHREWYHVH 133
           S R H E + VH
Sbjct: 187 STRRHHERFQVH 198


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,371,056
Number of Sequences: 59808
Number of extensions: 540087
Number of successful extensions: 1555
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1552
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2597949818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -