SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.)              172   3e-43
SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.60 
SB_42238| Best HMM Match : Trypsin (HMM E-Value=0)                     32   0.60 
SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033)                   30   2.4  
SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007)                  29   4.2  
SB_20635| Best HMM Match : rve (HMM E-Value=0.91)                      29   5.6  
SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.6  
SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_52533| Best HMM Match : rve (HMM E-Value=2)                         29   5.6  
SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7)                  29   5.6  
SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33)                     29   5.6  
SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36)               28   9.8  
SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17)                 28   9.8  
SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                 28   9.8  

>SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score =  172 bits (419), Expect = 3e-43
 Identities = 85/106 (80%), Positives = 93/106 (87%), Gaps = 1/106 (0%)
 Frame = +1

Query: 229 QTREHLLVF-LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 405
           +T EH+ +F LPIKEFEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG
Sbjct: 24  KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83

Query: 406 HIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           H+GLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 84  HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVP 129



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 40/141 (28%), Positives = 58/141 (41%)
 Frame = +2

Query: 179 WVPVTKLGRLVREGKIDKLESIYLFFYQSKNSRSLISSSARP*MMRFLRSCLYRNKHVPD 358
           WVPVTKLGRLV++ KI  LE IYLF    K    +            L+    + +    
Sbjct: 8   WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAG 67

Query: 359 SAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVTR*ESHTT 538
                +  + +  +   +      +++        + L      PVRR Y   +     T
Sbjct: 68  QRTRFKAFVAIGDSNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127

Query: 539 VPCKVXGQXWFPKQFRLIPAP 601
           VPCKV G+     + RLIPAP
Sbjct: 128 VPCKVTGKCG-STRVRLIPAP 147


>SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1049

 Score = 32.3 bits (70), Expect = 0.60
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = -2

Query: 480 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 301
           ++ + NS  N   D        TNMT + + G  CL     + TC+ L   DL NL+ + 
Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292

Query: 300 RAEEEI 283
           R ++E+
Sbjct: 293 RNQDEL 298


>SB_42238| Best HMM Match : Trypsin (HMM E-Value=0)
          Length = 657

 Score = 32.3 bits (70), Expect = 0.60
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = -2

Query: 480 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 301
           ++ + NS  N   D        TNMT + + G  CL     + TC+ L   DL NL+ + 
Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576

Query: 300 RAEEEI 283
           R ++E+
Sbjct: 577 RNQDEL 582


>SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033)
          Length = 382

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 14/37 (37%), Positives = 17/37 (45%)
 Frame = -3

Query: 203 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 93
           G +W +   L  LP     H  DHDR H  RH   +H
Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139


>SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007)
          Length = 280

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 19/44 (43%), Positives = 23/44 (52%)
 Frame = -2

Query: 453 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 322
           N  G  LA  +   N+  +V NG K  + C LS T L LY HDL
Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147


>SB_20635| Best HMM Match : rve (HMM E-Value=0.91)
          Length = 748

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
           N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192


>SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 945

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
           N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848


>SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2211

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307  NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
            N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045


>SB_52533| Best HMM Match : rve (HMM E-Value=2)
          Length = 212

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
           N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 95  NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132


>SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7)
          Length = 212

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
           N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 9   NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46


>SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33)
          Length = 735

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 307 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 420
           N  +LK++ +  Q +A  +  F+ FVA   +  H G G
Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569


>SB_50457| Best HMM Match : Amidase (HMM E-Value=2.6e-36)
          Length = 391

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 14/45 (31%), Positives = 22/45 (48%)
 Frame = -1

Query: 616 PITHGGGRNQPELFREPXLPXDFARDGCVAFLSCYPVTSSDWLEL 482
           PI      N   ++R   L   FA++G V  L C P+T  D +++
Sbjct: 54  PINAISSINPNAIYRAQQLDKIFAKNGIVGELFCIPITIKDNIDI 98


>SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17)
          Length = 1130

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = +3

Query: 357 TAHTFQGICCHWRQQRSYW 413
           TA  +  ICCH +Q + +W
Sbjct: 486 TADQYDAICCHTQQSKKFW 504


>SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0)
          Length = 897

 Score = 28.3 bits (60), Expect = 9.8
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +1

Query: 355 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 444
           G++ + K F+A+G  NGH+     C  ++A
Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,900,326
Number of Sequences: 59808
Number of extensions: 526228
Number of successful extensions: 1207
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1072
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1206
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2824376637
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -