SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)              103   2e-22
SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)             102   3e-22
SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17)        102   3e-22
SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)              101   1e-21
SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)                       101   1e-21
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                    100   1e-21
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)              100   1e-21
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                 100   1e-21
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                   100   1e-21
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)          100   1e-21
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                    100   1e-21
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)            100   1e-21
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)         100   1e-21
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                  100   1e-21
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                       100   1e-21
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)          100   1e-21
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                  100   1e-21
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                   100   1e-21
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                   100   1e-21
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)                      100   1e-21
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)              100   1e-21
SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                     100   1e-21
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)               100   1e-21
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                     100   1e-21
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)              100   1e-21
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)               100   1e-21
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)                   100   1e-21
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                   100   1e-21
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46412| Best HMM Match : HEAT (HMM E-Value=8)                       100   1e-21
SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)                    100   1e-21
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                   100   1e-21
SB_46308| Best HMM Match : IMS (HMM E-Value=0)                        100   1e-21
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)              100   1e-21
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                100   1e-21
SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)                     100   1e-21
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                100   1e-21
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003)              100   1e-21
SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)                   100   1e-21
SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)       100   1e-21
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                  100   1e-21
SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                   100   1e-21
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)               100   1e-21
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)                100   1e-21
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)               100   1e-21
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                100   1e-21
SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)              100   1e-21
SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2)            100   1e-21
SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)              100   1e-21
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)            100   1e-21
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78)             100   1e-21
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)            100   1e-21
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34793| Best HMM Match : TIL (HMM E-Value=4.5)                      100   1e-21
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                        100   1e-21
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)                100   1e-21
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0)                100   1e-21
SB_32525| Best HMM Match : DED (HMM E-Value=0.81)                     100   1e-21
SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)             100   1e-21
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6)                   100   1e-21
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31658| Best HMM Match : Arm (HMM E-Value=0.91)                     100   1e-21
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)             100   1e-21
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076)                   100   1e-21
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13)                    100   1e-21
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4)             100   1e-21
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021)                  100   1e-21
SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05)                    100   1e-21
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)                    100   1e-21
SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29332| Best HMM Match : PAN (HMM E-Value=0.039)                    100   1e-21
SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8)                    100   1e-21
SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2)                   100   1e-21
SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3)                  100   1e-21
SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5)                     100   1e-21
SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13)                 100   1e-21
SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_26735| Best HMM Match : rve (HMM E-Value=0.00066)                  100   1e-21
SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2)               100   1e-21
SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2)                     100   1e-21
SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24859| Best HMM Match : HAP (HMM E-Value=6.4)                      100   1e-21
SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3)                   100   1e-21
SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23850| Best HMM Match : SMP (HMM E-Value=4.9)                      100   1e-21
SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015)                   100   1e-21
SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6)            100   1e-21
SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6)                  100   1e-21
SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9)                100   1e-21
SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6)                100   1e-21
SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5)                100   1e-21
SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6)              100   1e-21
SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21
SB_22468| Best HMM Match : CUT (HMM E-Value=6.8)                      100   1e-21
SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.)             100   1e-21

>SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 925

 Score =  103 bits (247), Expect = 2e-22
 Identities = 45/58 (77%), Positives = 52/58 (89%)
 Frame = -3

Query: 176 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
           ++++  + P+  + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 575


>SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 498

 Score =  102 bits (245), Expect = 3e-22
 Identities = 48/57 (84%), Positives = 51/57 (89%)
 Frame = -3

Query: 173 NINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
           N+ A + PF +  RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 494


>SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17)
          Length = 629

 Score =  102 bits (245), Expect = 3e-22
 Identities = 46/52 (88%), Positives = 50/52 (96%)
 Frame = -3

Query: 158 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
           +L ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 508


>SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  101 bits (241), Expect = 1e-21
 Identities = 46/50 (92%), Positives = 47/50 (94%)
 Frame = -3

Query: 152 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
           P A + RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 52  PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 101


>SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)
          Length = 232

 Score =  101 bits (241), Expect = 1e-21
 Identities = 47/56 (83%), Positives = 50/56 (89%)
 Frame = -3

Query: 170 INAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
           + A + PF +  RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 228


>SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 36  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 87  DAPCSGALSAAGVVVTRSVTAT 108


>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 63  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107


>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 45  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 89



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 96  DAPCSGALSAAGVVVTRSVTAT 117


>SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 63  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 107



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 114 DAPCSGALSAAGVVVTRSVTAT 135


>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 68  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140


>SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 39  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 90  DAPCSGALSAAGVVVTRSVTAT 111


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 59  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131


>SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 71  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 115



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 122 DAPCSGALSAAGVVVTRSVTAT 143


>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 47  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 98  DAPCSGALSAAGVVVTRSVTAT 119


>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 36  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 87  DAPCSGALSAAGVVVTRSVTAT 108


>SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 26  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70


>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 51  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 60  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 111 DAPCSGALSAAGVVVTRSVTAT 132


>SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 54  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 105 DAPCSGALSAAGVVVTRSVTAT 126


>SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 70  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 121 DAPCSGALSAAGVVVTRSVTAT 142


>SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130


>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 41  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 92  DAPCSGALSAAGVVVTRSVTAT 113


>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
          Length = 297

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 217 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 261



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 268 DAPCSGALSAAGVVVTRSVTAT 289


>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 163 DAPCSGALSAAGVVVTRSVTAT 184


>SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 50  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94


>SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 29  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73


>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 17  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 48  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 99  DAPCSGALSAAGVVVTRSVTAT 120


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 382 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 426



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 433 DAPCSGALSAAGVVVTRSVTAT 454


>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74


>SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)
          Length = 198

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 108 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 152



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 159 DAPCSGALSAAGVVVTRSVTAT 180


>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 84  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 135 DAPCSGALSAAGVVVTRSVTAT 156


>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 40  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 91  DAPCSGALSAAGVVVTRSVTAT 112


>SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 9   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 60  DAPCSGALSAAGVVVTRSVTAT 81


>SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 19  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 63


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 39  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 90  DAPCSGALSAAGVVVTRSVTAT 111


>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 104 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 148



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 155 DAPCSGALSAAGVVVTRSVTAT 176


>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 46  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 97  DAPCSGALSAAGVVVTRSVTAT 118


>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 385



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 392 DAPCSGALSAAGVVVTRSVTAT 413


>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 81  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 125



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 132 DAPCSGALSAAGVVVTRSVTAT 153


>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 51  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123


>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 17  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 60  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 111 DAPCSGALSAAGVVVTRSVTAT 132


>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 135 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 179



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 186 DAPCSGALSAAGVVVTRSVTAT 207


>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 64  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 115 DAPCSGALSAAGVVVTRSVTAT 136


>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 40  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 91  DAPCSGALSAAGVVVTRSVTAT 112


>SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)
          Length = 295

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 144 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 188



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 195 DAPCSGALSAAGVVVTRSVTAT 216


>SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 917

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 834 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 878


>SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 17  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61


>SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 61  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 112 DAPCSGALSAAGVVVTRSVTAT 133


>SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 35  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 86  DAPCSGALSAAGVVVTRSVTAT 107


>SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 74  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 125 DAPCSGALSAAGVVVTRSVTAT 146


>SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 57  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129


>SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 70  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 114



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 121 DAPCSGALSAAGVVVTRSVTAT 142


>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 257 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 301



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 308 DAPCSGALSAAGVVVTRSVTAT 329


>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)
          Length = 195

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 115 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159


>SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 51  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 38  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 89  DAPCSGALSAAGVVVTRSVTAT 110


>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 102 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 146



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 153 DAPCSGALSAAGVVVTRSVTAT 174


>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 115 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 159



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 166 DAPCSGALSAAGVVVTRSVTAT 187


>SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 40  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84


>SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 21  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 65


>SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 59  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131


>SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 38  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 89  DAPCSGALSAAGVVVTRSVTAT 110


>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 35  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 86  DAPCSGALSAAGVVVTRSVTAT 107


>SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)
          Length = 349

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 12  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 56


>SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 20  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 64


>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 487

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 397 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 441



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 448 DAPCSGALSAAGVVVTRSVTAT 469


>SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 46  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 97  DAPCSGALSAAGVVVTRSVTAT 118


>SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 55  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127


>SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 120 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 164



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 171 DAPCSGALSAAGVVVTRSVTAT 192


>SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 56  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 107 DAPCSGALSAAGVVVTRSVTAT 128


>SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 66  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138


>SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 69  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 120 DAPCSGALSAAGVVVTRSVTAT 141


>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
          Length = 1401

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 415 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 459



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 466 DAPCSGALSAAGVVVTRSVTAT 487


>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)
          Length = 174

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 112 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 156


>SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)
          Length = 157

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 68  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140


>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 57  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129


>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
          Length = 137

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 47  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 98  DAPCSGALSAAGVVVTRSVTAT 119


>SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 162 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 206



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 213 DAPCSGALSAAGVVVTRSVTAT 234


>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 66  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138


>SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 53  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 97



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 104 DAPCSGALSAAGVVVTRSVTAT 125


>SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 89  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133


>SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 38  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 64  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 108



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 115 DAPCSGALSAAGVVVTRSVTAT 136


>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 43  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87


>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 186 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 230



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 237 DAPCSGALSAAGVVVTRSVTAT 258


>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 35  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 86  DAPCSGALSAAGVVVTRSVTAT 107


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 41  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 92  DAPCSGALSAAGVVVTRSVTAT 113


>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 55  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127


>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 142

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 52  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 103 DAPCSGALSAAGVVVTRSVTAT 124


>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 35  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 86  DAPCSGALSAAGVVVTRSVTAT 107


>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 36  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 87  DAPCSGALSAAGVVVTRSVTAT 108


>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 50  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122


>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 40  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 91  DAPCSGALSAAGVVVTRSVTAT 112


>SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 133 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 177


>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 42  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 93  DAPCSGALSAAGVVVTRSVTAT 114


>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 85  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 136 DAPCSGALSAAGVVVTRSVTAT 157


>SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 23  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67


>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_52085| Best HMM Match : TIL (HMM E-Value=2.5)
          Length = 234

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 154 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 198


>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 473

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 341 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 385



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 392 DAPCSGALSAAGVVVTRSVTAT 413


>SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102


>SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 22  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66


>SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)
          Length = 301

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 110 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 154



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 161 DAPCSGALSAAGVVVTRSVTAT 182


>SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 87  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 131



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 138 DAPCSGALSAAGVVVTRSVTAT 159


>SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 61  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 105


>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
          Length = 385

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 295 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 339



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 346 DAPCSGALSAAGVVVTRSVTAT 367


>SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130


>SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 59  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 103



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 110 DAPCSGALSAAGVVVTRSVTAT 131


>SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 17  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61


>SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 857

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 412 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 456



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 463 DAPCSGALSAAGVVVTRSVTAT 484


>SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 96  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 140



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 147 DAPCSGALSAAGVVVTRSVTAT 168


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 52  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 96



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 103 DAPCSGALSAAGVVVTRSVTAT 124


>SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 937

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/46 (97%), Positives = 45/46 (97%)
 Frame = -3

Query: 140  QXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 3
            Q RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT
Sbjct: 888  QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTT 933


>SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 94  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 138



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 145 DAPCSGALSAAGVVVTRSVTAT 166


>SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 212 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 256



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 263 DAPCSGALSAAGVVVTRSVTAT 284


>SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1615

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 214 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 258


>SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 34  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 78


>SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 49  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93


>SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 39  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 90  DAPCSGALSAAGVVVTRSVTAT 111


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 148 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 192



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 199 DAPCSGALSAAGVVVTRSVTAT 220


>SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 46  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 97  DAPCSGALSAAGVVVTRSVTAT 118


>SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 36  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 87  DAPCSGALSAAGVVVTRSVTAT 108


>SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 56  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 100



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 107 DAPCSGALSAAGVVVTRSVTAT 128


>SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 41  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85


>SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 76  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120


>SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)
          Length = 286

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 196 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 240



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 247 DAPCSGALSAAGVVVTRSVTAT 268


>SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 54  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 98



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 105 DAPCSGALSAAGVVVTRSVTAT 126


>SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 33  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 77



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 84  DAPCSGALSAAGVVVTRSVTAT 105


>SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 237

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 87  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 131



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 138 DAPCSGALSAAGVVVTRSVTAT 159


>SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 23  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67


>SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 50  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122


>SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)
          Length = 325

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 188 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 232



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 239 DAPCSGALSAAGVVVTRSVTAT 260


>SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130


>SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 68  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 112



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 119 DAPCSGALSAAGVVVTRSVTAT 140


>SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 51  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123


>SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102


>SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016)
          Length = 318

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 101 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145


>SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 77  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 121



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 128 DAPCSGALSAAGVVVTRSVTAT 149


>SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 97  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 148 DAPCSGALSAAGVVVTRSVTAT 169


>SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6)
          Length = 154

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 74  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 118


>SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 41  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85


>SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 50  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 94



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 101 DAPCSGALSAAGVVVTRSVTAT 122


>SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 754

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 664 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 708



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 715 DAPCSGALSAAGVVVTRSVTAT 736


>SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)
          Length = 139

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 49  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 93



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 100 DAPCSGALSAAGVVVTRSVTAT 121


>SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 38  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 82



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 89  DAPCSGALSAAGVVVTRSVTAT 110


>SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 29  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 73


>SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 562

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 147 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 191


>SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 39  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 83



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 90  DAPCSGALSAAGVVVTRSVTAT 111


>SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_46412| Best HMM Match : HEAT (HMM E-Value=8)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 60  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 104


>SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 89  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 133


>SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_46344| Best HMM Match : ig (HMM E-Value=0.0082)
          Length = 181

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 101 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 145


>SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_46308| Best HMM Match : IMS (HMM E-Value=0)
          Length = 1245

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1    AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
            AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 1191 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1235



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 33/40 (82%), Positives = 35/40 (87%)
 Frame = -3

Query: 164 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSW 45
           A + PF +  RNCWEGRSVRASSLLRQLAKGGCAARRLSW
Sbjct: 402 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSW 439


>SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 43  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 87



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 94  DAPCSGALSAAGVVVTRSVTAT 115


>SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 33  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 77


>SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 126 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 170


>SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 57  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 101



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 108 DAPCSGALSAAGVVVTRSVTAT 129


>SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 78  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 122


>SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 51  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 95



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 102 DAPCSGALSAAGVVVTRSVTAT 123


>SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 324

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 178 DAPCSGALSAAGVVVTRSVTAT 199


>SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 259

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 169 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 213



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 220 DAPCSGALSAAGVVVTRSVTAT 241


>SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 32  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 76


>SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 81  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 125



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 132 DAPCSGALSAAGVVVTRSVTAT 153


>SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 31  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 75



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 18/22 (81%), Positives = 18/22 (81%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCS ALSAAGVVV   VTAT
Sbjct: 82  DAPCSAALSAAGVVVTRSVTAT 103


>SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 46  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 97  DAPCSGALSAAGVVVTRSVTAT 118


>SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 17  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 61


>SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)
          Length = 496

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 76  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 127 DAPCSGALSAAGVVVTRSVTAT 148


>SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)
          Length = 1016

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1    AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
            AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 926  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 970



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608  DAPCSGALSAAGVVVYAHVTAT 543
            DAPCSGALSAAGVVV   VTAT
Sbjct: 977  DAPCSGALSAAGVVVTRSVTAT 998


>SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 89

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 35  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 79


>SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81


>SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 47  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 91



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 98  DAPCSGALSAAGVVVTRSVTAT 119


>SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 37  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 81



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 88  DAPCSGALSAAGVVVTRSVTAT 109


>SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 97  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 141


>SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)
          Length = 718

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 354 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 398



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 405 DAPCSGALSAAGVVVTRSVTAT 426


>SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 84  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 128



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 135 DAPCSGALSAAGVVVTRSVTAT 156


>SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 66  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 117 DAPCSGALSAAGVVVTRSVTAT 138


>SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)
          Length = 166

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 76  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 120



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 127 DAPCSGALSAAGVVVTRSVTAT 148


>SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003)
          Length = 227

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 9   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 60  DAPCSGALSAAGVVVTRSVTAT 81


>SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 62  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 106


>SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 85  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129


>SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 30  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 74



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 81  DAPCSGALSAAGVVVTRSVTAT 102


>SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 41  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85


>SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 217

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 127 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 171



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 178 DAPCSGALSAAGVVVTRSVTAT 199


>SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2)
          Length = 165

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 85  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129


>SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)
          Length = 1709

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1    AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
            AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 1474 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 1518



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608  DAPCSGALSAAGVVVYAHVTAT 543
            DAPCSGALSAAGVVV   VTAT
Sbjct: 1525 DAPCSGALSAAGVVVTRSVTAT 1546


>SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 98  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 142



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 149 DAPCSGALSAAGVVVTRSVTAT 170


>SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 58  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 102



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 109 DAPCSGALSAAGVVVTRSVTAT 130


>SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 55  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 99



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 106 DAPCSGALSAAGVVVTRSVTAT 127


>SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 105 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 149



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 156 DAPCSGALSAAGVVVTRSVTAT 177


>SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 48  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 92



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 99  DAPCSGALSAAGVVVTRSVTAT 120


>SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 85  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 129


>SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)
          Length = 999

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1    AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
            AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 909  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 953



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608  DAPCSGALSAAGVVVYAHVTAT 543
            DAPCSGALSAAGVVV   VTAT
Sbjct: 960  DAPCSGALSAAGVVVTRSVTAT 981


>SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 22  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 66


>SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 66  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 110


>SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)
          Length = 130

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 40  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 84



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 91  DAPCSGALSAAGVVVTRSVTAT 112


>SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 44  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 88



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 95  DAPCSGALSAAGVVVTRSVTAT 116


>SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 42  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 86



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 93  DAPCSGALSAAGVVVTRSVTAT 114


>SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 25  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 69


>SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 109 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 153


>SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 82  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 126



 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVY 561
           DAPCSGALSAAG  V+
Sbjct: 133 DAPCSGALSAAGSNVH 148


>SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)
          Length = 180

 Score =  100 bits (240), Expect = 1e-21
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 1   AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 135
           AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR
Sbjct: 90  AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 134



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/22 (86%), Positives = 19/22 (86%)
 Frame = -3

Query: 608 DAPCSGALSAAGVVVYAHVTAT 543
           DAPCSGALSAAGVVV   VTAT
Sbjct: 141 DAPCSGALSAAGVVVTRSVTAT 162


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,523,718
Number of Sequences: 59808
Number of extensions: 544585
Number of successful extensions: 8464
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 5067
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8458
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2514529411
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -