SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49200| Best HMM Match : GatB (HMM E-Value=6.4)                      41   0.001
SB_20698| Best HMM Match : Keratin_B2 (HMM E-Value=0.16)               36   0.043
SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22)              31   0.92 
SB_31531| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_38369| Best HMM Match : E-MAP-115 (HMM E-Value=1.7)                 29   3.7  
SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.9  
SB_33458| Best HMM Match : HEAT (HMM E-Value=7.9e-15)                  29   6.5  

>SB_49200| Best HMM Match : GatB (HMM E-Value=6.4)
          Length = 151

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = +1

Query: 568 LARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHSGFVVQL 714
           +A + +++V L DL LD HA  K   LVG+RY+P  D +TI +  +V +
Sbjct: 92  MANLELMKVFLKDLILDDHARTKLIELVGERYNPVDDSLTIITDRLVSM 140


>SB_20698| Best HMM Match : Keratin_B2 (HMM E-Value=0.16)
          Length = 376

 Score = 35.9 bits (79), Expect = 0.043
 Identities = 18/33 (54%), Positives = 21/33 (63%)
 Frame = +1

Query: 592 VQLADLKLDKHATDKFKRLVGDRYDPKTDLVTI 690
           V L DL LD HA  K   LVG+RY+P  D +TI
Sbjct: 1   VFLKDLILDDHARTKLIELVGERYNPVDDSLTI 33


>SB_31228| Best HMM Match : EMP24_GP25L (HMM E-Value=0.22)
          Length = 350

 Score = 31.5 bits (68), Expect = 0.92
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +3

Query: 102 RLNSTSADSALKKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRIDRMAQT 260
           RL   + + A +K EEEE  R+ +I ++++KM ++  +       ++D + Q+
Sbjct: 105 RLRIQAEEEARRKAEEEERIRIEEIKRQQEKMLQQQQQHPVAATQQVDGLQQS 157


>SB_31531| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = +3

Query: 135 KKGEEEEEFRVLDILKKRDKMQRRVVKRTDVQPDRIDRMAQ 257
           ++GE E       +L K+ + Q ++++RTD Q D ++++ Q
Sbjct: 126 RRGERERTTNKAKLLLKKKRYQEQLLQRTDNQLDNLEKLVQ 166


>SB_38369| Best HMM Match : E-MAP-115 (HMM E-Value=1.7)
          Length = 412

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%)
 Frame = +2

Query: 281 PGPKTFHPSSVPLPIRQGYVPKGQAP--PGK 367
           PG     P   PLP+ Q ++P GQ P  PG+
Sbjct: 212 PGQTPMLPGQTPLPLGQTFMPLGQVPMLPGQ 242


>SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1646

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254  PNQNWGNVWPGPKTFHPSSVP-LPIRQGYVPKGQAPPGKKANAELMKIPNFLHLTPP 421
            P Q WGN  PG  T  PS VP +    G  P+    P    N   +  P+     PP
Sbjct: 1582 PAQLWGNSHPGAATGFPSQVPSMWSFSGGAPR-DVEPQSGTNENGLVSPSMTTFLPP 1637


>SB_33458| Best HMM Match : HEAT (HMM E-Value=7.9e-15)
          Length = 875

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +3

Query: 60  KSGCFNSACNVKLWRLNSTSADSALKKGEEE---EEFRVLDILKKRDKMQRRV 209
           +  C N+ C + +WR++ + A++ L +   E     FR+L  L    K +R +
Sbjct: 642 EGACDNNTCCIPMWRISFSLAEATLIRSLNEVHKNSFRILKALINSAKEKRLI 694


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,615,140
Number of Sequences: 59808
Number of extensions: 570680
Number of successful extensions: 3298
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 3169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3295
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2467263854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -