SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0)                     62   8e-10
SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0)                     62   8e-10
SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0)                     61   1e-09
SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_38405| Best HMM Match : BACK (HMM E-Value=0)                        58   1e-08
SB_18403| Best HMM Match : BACK (HMM E-Value=0)                        58   1e-08
SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37)                   54   2e-07
SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.)               53   4e-07
SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   5e-07
SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0)                     52   5e-07
SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0)                     52   8e-07
SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0)                     51   1e-06
SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45)               51   1e-06
SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0)                     50   3e-06
SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0)                     49   4e-06
SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0)                      48   1e-05
SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36)                   48   1e-05
SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0)                     47   2e-05
SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42)           45   7e-05
SB_11910| Best HMM Match : Kelch_1 (HMM E-Value=0)                     45   9e-05
SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   2e-04
SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0)                      42   7e-04
SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   9e-04
SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0)                     40   0.002
SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.005
SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38)                   39   0.006
SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13)                 39   0.006
SB_23075| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42)              38   0.011
SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30)                   35   0.099
SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23)                   33   0.40 
SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30)                32   0.53 
SB_49590| Best HMM Match : BTB (HMM E-Value=4.8e-06)                   31   1.2  
SB_13356| Best HMM Match : BACK (HMM E-Value=5.1e-16)                  31   1.6  
SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18)                   29   3.7  
SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.7  
SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36)                   29   4.9  
SB_25077| Best HMM Match : BTB (HMM E-Value=1.4e-10)                   29   6.5  
SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   6.5  
SB_33162| Best HMM Match : EGF (HMM E-Value=1.2e-06)                   28   8.6  
SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.6  

>SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 548

 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 30/69 (43%), Positives = 40/69 (57%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   ++S +NP NCLGI T A +  C  L   A +Y+L  F TV +Q+DEF  LP D+L 
Sbjct: 140 CVSFMKSMINPSNCLGIETAANQFDCEALRKTANQYILDNFATV-SQTDEFKSLPADKLE 198

Query: 704 SIILEDELK 730
             +  DE K
Sbjct: 199 EFLSSDETK 207



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSD---VLISGVRSXXXXXXXXXXXXXXI 449
           +G  F  HR +L+A SPYF A+F++  H REQ++   V++  + +              I
Sbjct: 57  NGKPFYAHRNVLAAASPYFRAMFSS--HFREQNESKPVILENITADVMEELLNFIYAGTI 114

Query: 450 DVTDTNVHELLMTADYL 500
            +T  NV +L+  ++YL
Sbjct: 115 KITPFNVKDLVSASNYL 131


>SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 570

 Score = 61.7 bits (143), Expect = 8e-10
 Identities = 30/69 (43%), Positives = 40/69 (57%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C   ++S +NP NCLGI T A +  C  L   A +Y+L  F TV +Q+DEF  LP D+L 
Sbjct: 140 CVSFMKSMINPSNCLGIETAANQFDCEALRKTANQYILDNFATV-SQTDEFKSLPADKLE 198

Query: 704 SIILEDELK 730
             +  DE K
Sbjct: 199 EFLSSDETK 207



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSD---VLISGVRSXXXXXXXXXXXXXXI 449
           +G  F  HR +L+A SPYF A+F++  H REQ++   V++  + +              I
Sbjct: 57  NGKPFYAHRNVLAAASPYFRAMFSS--HFREQNESKPVILENITADVMEELLNFIYAGTI 114

Query: 450 DVTDTNVHELLMTADYL 500
            +T  NV +L+  ++YL
Sbjct: 115 KITPFNVKDLVSASNYL 131


>SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 628

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 30/78 (38%), Positives = 48/78 (61%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V + CC+ L+  L+P+NCLGI  FA    C +L   +  +   +FV V  QS+E
Sbjct: 112 LLQVQSVQEACCEFLKRQLSPENCLGICAFADSHSCTELVKFSDAFARLHFVDV-VQSEE 170

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ +PL +L+ I++ED+L
Sbjct: 171 FMDVPLKQLSRILVEDDL 188


>SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 613

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 27/75 (36%), Positives = 47/75 (62%)
 Frame = +2

Query: 500 RFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFL 679
           + P ++ +C + L+  L+P NCLGI+  A R  C +L  +A +Y +++F  V ++ DEF 
Sbjct: 164 QIPEIINVCSEFLKEQLHPSNCLGILALADRFSCEELANEAHKYTVKHFGRV-SECDEFK 222

Query: 680 HLPLDELNSIILEDE 724
            LP +E+  ++L DE
Sbjct: 223 ALPFNEI-KLLLNDE 236



 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 29/90 (32%), Positives = 43/90 (47%)
 Frame = +3

Query: 222 GAPSTARVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVR 401
           G  S   +   CD  +  +DG S  VHR +L+A SPYF A+FT  L    ++ +L+ G+ 
Sbjct: 71  GLFSQIGLKELCDVTLETEDGLSIAVHRNVLAAVSPYFRAMFTGNLLESGKNRILLKGIA 130

Query: 402 SXXXXXXXXXXXXXXIDVTDTNVHELLMTA 491
                          I++ D NV E+L  A
Sbjct: 131 GVALQALLDYVYTSSIEIFDDNVEEVLNAA 160


>SB_38405| Best HMM Match : BACK (HMM E-Value=0)
          Length = 423

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V   CC+ L++ L+P NCLGI +FA    C  L   + R+ L++FV V +Q++E
Sbjct: 121 LLQLESVKDACCEFLKNQLHPSNCLGIRSFADVHVCTDLHESSYRFALQHFVEV-SQTEE 179

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ L ++E+  +I  ++L
Sbjct: 180 FMLLKVNEVLDLISSNDL 197



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 26/85 (30%), Positives = 40/85 (47%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD ++   D   +  HR +L+ACS YF A+FT+ L    Q ++ + G++        
Sbjct: 39  SELCDVVLLVGDRRIY-AHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLV 97

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  I V++ NV  LL  A  L
Sbjct: 98  EFAYTARIQVSEDNVQALLPAASLL 122


>SB_18403| Best HMM Match : BACK (HMM E-Value=0)
          Length = 423

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 28/78 (35%), Positives = 48/78 (61%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +   V   CC+ L++ L+P NCLGI +FA    C  L   + R+ L++FV V +Q++E
Sbjct: 121 LLQLESVKDACCEFLKNQLHPSNCLGIRSFADVHVCTDLHESSYRFALQHFVEV-SQTEE 179

Query: 674 FLHLPLDELNSIILEDEL 727
           F+ L ++E+  +I  ++L
Sbjct: 180 FMLLKVNEVLDLISSNDL 197



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 26/85 (30%), Positives = 40/85 (47%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD ++   D   +  HR +L+ACS YF A+FT+ L    Q ++ + G++        
Sbjct: 39  SELCDVVLLVGDRRIY-AHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLV 97

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  I V++ NV  LL  A  L
Sbjct: 98  EFAYTARIQVSEDNVQALLPAASLL 122


>SB_30927| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 501

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 28/68 (41%), Positives = 41/68 (60%)
 Frame = +2

Query: 518 QLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDE 697
           Q CC  L++ L+  NCLGI  FA    C +LE  A +Y+ ++F+ V  + DEFL LP  +
Sbjct: 117 QACCSFLQTHLDASNCLGIRAFADLYSCTELENAAFKYICQHFLDV-IKCDEFLQLPYRD 175

Query: 698 LNSIILED 721
           L S++  D
Sbjct: 176 LKSLLESD 183



 Score = 36.3 bits (80), Expect = 0.033
 Identities = 21/82 (25%), Positives = 33/82 (40%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++    G  F  HR +L+  S Y  A+FT  +      D+ + G+            
Sbjct: 30  CDVLLHVG-GREFRGHRIVLAGASSYLRAMFTNGMLESGMRDIKLQGIDPAVMEILLDFV 88

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               +D++  NV  LL  A  L
Sbjct: 89  YTGIVDISVENVQALLSGATLL 110


>SB_4030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 809

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 30/78 (38%), Positives = 47/78 (60%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +F  V++ C D L+  L+  NCLGI  FA    C KL+  A+ Y  ++F+ VA +SDE
Sbjct: 115 LLQFTTVVETCSDFLKKQLHATNCLGIGNFADHHGCGKLKLAAQSYAEKHFLDVA-KSDE 173

Query: 674 FLHLPLDELNSIILEDEL 727
           FL    ++++S++  D L
Sbjct: 174 FLLATYEQISSMLKSDSL 191



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 23/84 (27%), Positives = 36/84 (42%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  V        P HR IL+A S YF ++FT+ +    Q+ + +  V +          
Sbjct: 36  CDVTVVVGK-MEIPSHRLILAANSSYFYSMFTSGMSETAQNRINLKEVDATVVRQLIEYC 94

Query: 435 XXXXIDVTDTNVHELLMTADYLAF 506
               I++ + NV  LL   + L F
Sbjct: 95  YTSTIEINENNVQNLLSIGNLLQF 118


>SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37)
          Length = 521

 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 28/87 (32%), Positives = 45/87 (51%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R+++ CDA+++ ++   FP+H+ ++SA SPYF  LF+  L       V I G+ S     
Sbjct: 29  RLNTMCDAVLKVEE-KQFPIHKIVVSASSPYFEVLFSGGLRESYLDTVTIQGIDSETFSA 87

Query: 420 XXXXXXXXXIDVTDTNVHELLMTADYL 500
                    I+V + NV +LL  A  L
Sbjct: 88  LLDFIYTGVINVNEENVQQLLPAAKML 114



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           +++ +   V + CCD L   L   NCLGI  FA    C  L  +A  ++ R FV V  +S
Sbjct: 111 AKMLQLDAVEKCCCDFLMRQLEHANCLGIYLFAEAHSCADLSTNALEFIHRNFVLVC-ES 169

Query: 668 DEFLHLPLDELNSIILEDELK 730
           +E+L L    L  ++  ++LK
Sbjct: 170 EEYLELDRWHLLQLLDSEDLK 190


>SB_8385| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 580

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/72 (38%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CCD L++ L+P NCLGI  FA    C  L      +  ++F  V  Q DEFL LP 
Sbjct: 126 VRDACCDFLKAQLHPSNCLGIRAFADMHSCPDLLRTGHIFAEQHFSEV-VQGDEFLGLPF 184

Query: 692 DELNSIILEDEL 727
            ++  +I  D+L
Sbjct: 185 MQVAELISSDQL 196



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 28/86 (32%), Positives = 41/86 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++A      P HR +L++ SPYF A+FT  L    Q+ V +  + S          
Sbjct: 41  CDVVLKAGS-IEIPAHRVVLASSSPYFFAMFTGELSESRQTVVTLKEIDSLALELLIEFV 99

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I+VT+ NV  LL  A+ L   E
Sbjct: 100 YIAEIEVTEDNVQVLLPAANLLQLNE 125


>SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 559

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 30/78 (38%), Positives = 40/78 (51%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L +F  V  LCC  L S L+P NCLGI  F     C K      +Y+L  F  V  +S+E
Sbjct: 91  LLQFHEVKDLCCQFLESQLDPSNCLGIRKFTESHGCCKFLEVIDKYVLENFKQV-MKSEE 149

Query: 674 FLHLPLDELNSIILEDEL 727
           +  LP + L  +I  D+L
Sbjct: 150 YALLPSELLVKVISSDDL 167



 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++R D+  S+  HRA+L++CS YF A+F   L   +Q  + +  +            
Sbjct: 12  CDVVLRIDE-QSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFA 70

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               +++T  NV  LL TA  L F E
Sbjct: 71  YTGRVEITVENVQNLLATASLLQFHE 96


>SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 590

 Score = 52.4 bits (120), Expect = 5e-07
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  L S LN  NCLGI +F+    C++L   A RY+ + FV V ++SDEFL +  
Sbjct: 119 VKDACCRFLESRLNVSNCLGIQSFSETYACHELWHIASRYVYQNFVHV-SESDEFLAMSP 177

Query: 692 DELNSIILEDEL 727
             +  +   DE+
Sbjct: 178 KNVAILFSSDEI 189



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/48 (43%), Positives = 28/48 (58%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           CD +++A+D   F  HR ILSA S YF A+F   +    Q  V I+GV
Sbjct: 34  CDVVIKAED-TEFLAHRNILSASSDYFFAMFNGNMKESSQDVVTITGV 80


>SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 823

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 28/72 (38%), Positives = 39/72 (54%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           + ++CC+ L+  L+P NCLGI  FA    C  L   A  +    F  V  +S+EFL LP 
Sbjct: 144 IQEICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRVADLFTQHNFQEV-MESEEFLLLPF 202

Query: 692 DELNSIILEDEL 727
            +L  I+  DEL
Sbjct: 203 AQLVDILSSDEL 214



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 26/86 (30%), Positives = 40/86 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +++    ++   HR +L+ACSPYF A+FT  +    Q+++ I  V            
Sbjct: 59  CDVVIKVGS-STIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITFA 117

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE 512
               I + +TNV  LL  A  L   E
Sbjct: 118 YTASITIEETNVQTLLPAACLLQLTE 143


>SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 651

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 31/80 (38%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   V Q C + L  +L+P NCLGI +FA    C  L   A  + L+ F  V +QS
Sbjct: 109 SSLLQLSNVKQACVEFLHRALHPANCLGIRSFADTFCCGDLVQAADVFALKNFSEV-SQS 167

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EF  L  DE+ ++I  +EL
Sbjct: 168 EEFQALAPDEVVALISSEEL 187



 Score = 30.3 bits (65), Expect = 2.1
 Identities = 20/82 (24%), Positives = 30/82 (36%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +   D  S   HR +L+  SPYF A+ T  +       V I G+            
Sbjct: 32  CDVTLVVKD-RSLVSHRVVLAGWSPYFHAMLTGDMLESRLEKVTIHGIECAALEELINFC 90

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
                ++   NV  L+  +  L
Sbjct: 91  YTGRTEIHVENVQSLMCASSLL 112


>SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45)
          Length = 554

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  +DG     H+ +LSA S YF A+F T +   +Q  + I  + S          
Sbjct: 26  CDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLVEFA 85

Query: 435 XXXXIDVTDTNVHELLMTADYLAFLE----CFSFV 527
               + +   NV  LL  A  L F+     C+ F+
Sbjct: 86  YTSNVRINSENVETLLYAASMLQFVRVEKACYEFL 120


>SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 481

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 26/80 (32%), Positives = 44/80 (55%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +   + + C + L   L+P NCLGI +FA    C  L   + +++  YF  V  ++
Sbjct: 124 SSLFQLNAIQKACSEFLERQLHPSNCLGIRSFADAHSCVGLLHASEKFINEYFSDV-VKN 182

Query: 668 DEFLHLPLDELNSIILEDEL 727
           +EFL LP +EL  ++  ++L
Sbjct: 183 EEFLLLPQEELAVLLSSEDL 202



 Score = 31.5 bits (68), Expect = 0.92
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR +L++ S YF A+FT  L    +  V +  V S              +D+T  NV  +
Sbjct: 61  HRLVLASFSSYFQAMFTGGLVESFEDSVTLRDVDSGAVELLVDFAYTGKLDITTENVQSI 120

Query: 480 L 482
           +
Sbjct: 121 M 121


>SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 587

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 25/82 (30%), Positives = 40/82 (48%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD +    +G  FP HR +L+A S YF  LFT+ +  +    V +  +R+          
Sbjct: 30  CD-VTLVVEGKEFPAHRIVLAASSKYFYGLFTSEMIEKNAPSVKLQELRASVMNHILTYL 88

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I VT+ N  +L+ +A+YL
Sbjct: 89  YTGEITVTELNAEDLIASANYL 110


>SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 645

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  L   L+  NCLGI  FA    C  L   A++++   F +V  Q +EFL LP 
Sbjct: 117 VKDACCQFLSDQLDYSNCLGISKFAEAFTCQTLVKKAKKFIQDNFRSVVEQ-EEFLLLPY 175

Query: 692 DELNSIILEDEL 727
             +  ++ +D L
Sbjct: 176 SHVTELLEDDNL 187



 Score = 40.7 bits (91), Expect = 0.002
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = +3

Query: 300 HRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTDTNVHEL 479
           HR +LSACS YF A+FT  L   ++  + I G+                 ++T  NV  L
Sbjct: 46  HRVVLSACSAYFDAMFTGNLLESKKQVIYIKGIDETALQLLVDFAYTGKAEITQENVQLL 105

Query: 480 LMTADYL 500
           L  A+ L
Sbjct: 106 LPAANML 112


>SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4527

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 5/120 (4%)
 Frame = +3

Query: 255  CDAIVRADDGAS-FPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXX 431
            CD I+ AD+G   FP HRA+L+A S YF  L+  T  +R   + ++SG+           
Sbjct: 3583 CDVIILADNGCRRFPAHRAVLAASSRYFHKLYNGTTLARYSRETILSGICDRELETVVHY 3642

Query: 432  XXXXXIDVTDTNVHELLMTADYLAF----LECFSFVAIISEVH*TQKTVLEL*LLQGVFS 599
                 + +   NV  LL  A  L      L C  +  ++  VH   +  +EL +L  ++S
Sbjct: 3643 IYTSEVCIDGDNVRALLHAAYNLGLDLLTLACEKY--LVENVH--HENSIELMVLAQMYS 3698


>SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36)
          Length = 574

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 23/82 (28%), Positives = 43/82 (52%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  ++   F  H+ IL+A S YF+A+FTT +  +EQ  V++  ++           
Sbjct: 41  CDVVLLVEN-EEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFL 99

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I++ + NV +LL  + +L
Sbjct: 100 YTGRIEIDNKNVRDLLEASSFL 121


>SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 592

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/82 (26%), Positives = 38/82 (46%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CDA+++   G + PVH+ +L A SP+F  LFT  +  + Q  + +  +            
Sbjct: 35  CDAVIQIG-GKTHPVHKNVLCAASPFFRGLFTNDMQEKNQEHIELQVISGDVGEEVISFM 93

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               I V   N  +++M  D+L
Sbjct: 94  YTGAIKVEKENAQDIVMAGDFL 115


>SB_36233| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 571

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P + QL  D L  +L   NCL I+  A +     L+ +A+RY L  F TV +Q++EF  L
Sbjct: 109 PKLKQLGIDFLSHNLTSANCLSILAIAEKFNFQTLKDNAQRYTLEQFGTV-SQAEEFERL 167

Query: 686 PLDELNSIILEDEL 727
            +++L +II  D+L
Sbjct: 168 NVEQLLAIISCDDL 181



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 22/82 (26%), Positives = 39/82 (47%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  +  ++   F  HR IL+A SPYF ALFT+ +   + +++ ++ V            
Sbjct: 26  CDVTLNVNE-VLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNVDVEIMEDILAYL 84

Query: 435 XXXXIDVTDTNVHELLMTADYL 500
               + V ++    L + ADY+
Sbjct: 85  YSGSVVVEESKAIPLTVAADYM 106


>SB_33725| Best HMM Match : Kelch_1 (HMM E-Value=3.59994e-42)
          Length = 635

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/83 (25%), Positives = 42/83 (50%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S CD  +  + G +F  HR +L+A SP+F  LFTT +  ++++ +++  V++        
Sbjct: 32  SLCDVDLMVE-GLTFSAHRLVLAAGSPFFHGLFTTEMKEKQENKIVLKQVKASVMENVLE 90

Query: 429 XXXXXXIDVTDTNVHELLMTADY 497
                   +   N  +L+++A Y
Sbjct: 91  YLYTGKTSLNPENAEDLVVSASY 113



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 20/71 (28%), Positives = 37/71 (52%)
 Frame = +2

Query: 509 GVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLP 688
           G+ +   + +RSSLN  NC+ +  FA +  C  L   AR ++ ++F  +    +EFL L 
Sbjct: 118 GLKEKASNFIRSSLNVDNCIQVREFAEKHDCKSLSLAARVFIGQHFGEI-INGEEFLGLE 176

Query: 689 LDELNSIILED 721
            +++   I  +
Sbjct: 177 FEKIEEFIASE 187


>SB_11910| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 456

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +2

Query: 548 LNPKNCLGIMTFARRVFCYK-LEADARRYLLRYFVTVATQSDEFLHLPLDELNSIILEDE 724
           + P NCLG+ + A R+FC   L   A R+ L +F +V  Q +EF  +P  +L S++ +D 
Sbjct: 1   MTPSNCLGLQSLA-RLFCLDGLSEHANRFALWHFQSV-YQEEEFNRVPYQQLKSLVQDDT 58

Query: 725 LK 730
           LK
Sbjct: 59  LK 60


>SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 600

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C + +R  L+P NCLGI +FA    C  L   A  +   +FV V  ++ EFL L  
Sbjct: 119 VKNACSEFMRHQLHPSNCLGIRSFADGHGCAHLLKAADAFTKEHFVEV-VKNQEFLLLSA 177

Query: 692 DELNSIILEDEL 727
           + +  ++  D+L
Sbjct: 178 ESVGELLSSDDL 189



 Score = 29.5 bits (63), Expect = 3.7
 Identities = 20/82 (24%), Positives = 33/82 (40%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD  +   D      H+ +L++ S YF A+FT  +    Q+ V ++ +         
Sbjct: 31  SQLCDIKIVIGD-KRIRAHKLVLASFSDYFSAMFTGDMAETSQNTVHLTDMDPAAVQALI 89

Query: 426 XXXXXXXIDVTDTNVHELLMTA 491
                  I++   NV  LL  A
Sbjct: 90  SYSYTSEIEIRVDNVENLLSVA 111


>SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 655

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 22/60 (36%), Positives = 35/60 (58%)
 Frame = +2

Query: 548 LNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELNSIILEDEL 727
           L+P NCLGI  FA    C +L+A A  ++ ++F T   +S+EF+ L  D++  +   D L
Sbjct: 103 LDPTNCLGIRAFADTHCCDELKAAAENFIHKHF-TEIVKSEEFMMLNSDDVMCLSKSDNL 161



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 16/50 (32%), Positives = 30/50 (60%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRS 404
           CD +++ +    FP HR +L++CS YF A+FT  +   ++  + + G+ S
Sbjct: 38  CDVVLQVEK-KEFPAHRIVLASCSDYFYAMFTNDMLESQKGVIELQGLAS 86


>SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 658

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 21/74 (28%), Positives = 40/74 (54%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHL 685
           P +   C + L S L+  NC  I   A +     L ++A  ++   FV ++  S+EF++L
Sbjct: 139 PALTDACIELLSSILSVDNCFSIRMIASKYNAKDLLSNADGFIKGNFVYLSLWSNEFIYL 198

Query: 686 PLDELNSIILEDEL 727
           P +E+ ++I  D++
Sbjct: 199 PCEEICNVISGDDI 212



 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 21/85 (24%), Positives = 41/85 (48%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD I++ + G  +PVHR +L+A SP+F  +F + +    Q  + +  +++       
Sbjct: 53  SGFCDVILQVE-GRHYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQLQSIKAKAMESIL 111

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  I + +  + +LL  A +L
Sbjct: 112 EFFYTQEIVLEEDELLDLLDAASFL 136


>SB_5771| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 595

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   CC  ++  L   NC GI + A R  C ++      ++   FV  AT ++EFL LP 
Sbjct: 118 VTHACCKFIQERLTLANCWGIRSLADRYNCREMLKKVTSFIEENFVD-ATATEEFLSLPE 176

Query: 692 DELNSIILEDEL 727
           +E+  ++ ++++
Sbjct: 177 EEVCQLLSDNDI 188



 Score = 37.5 bits (83), Expect = 0.014
 Identities = 21/80 (26%), Positives = 40/80 (50%)
 Frame = +3

Query: 240 RVSSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXX 419
           R  S    +V   DG  FP H+ IL+A S YF+A+F+  + + +++ V++  + S     
Sbjct: 28  RYHSILTDVVLIVDGHEFPAHKNILAASSDYFMAMFSGHMATVDRT-VVVQEITSTAMEV 86

Query: 420 XXXXXXXXXIDVTDTNVHEL 479
                    + +T+ NV ++
Sbjct: 87  LLAFIYQGKLLITEENVEDI 106


>SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2201

 Score = 41.5 bits (93), Expect = 9e-04
 Identities = 21/84 (25%), Positives = 38/84 (45%)
 Frame = +3

Query: 249 SACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXX 428
           S CD  ++      FP H+ +L+A S YF ALFTT +  +   ++ +  + +        
Sbjct: 27  SMCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLD-ISTRTLKAILK 85

Query: 429 XXXXXXIDVTDTNVHELLMTADYL 500
                 + +  +N   + + ADYL
Sbjct: 86  YVYCGDVSLNVSNARSVFVAADYL 109


>SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0)
          Length = 625

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/76 (26%), Positives = 34/76 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD  ++A +      HR +L++CS YF ++FT ++    Q  + I G+            
Sbjct: 34  CDVTIKAGE-RKIRCHRVVLASCSAYFHSMFTNSMLESSQEVITIQGLSEKSVIQLINFM 92

Query: 435 XXXXIDVTDTNVHELL 482
               I +T  N+  LL
Sbjct: 93  YTRKITITIDNIESLL 108



 Score = 34.7 bits (76), Expect = 0.099
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V+  CC+ ++  L+  NCL +  +A    C +    A ++    F T+ + +D FL L  
Sbjct: 119 VVYACCEFMKRHLHVSNCLEMRAYAELHGCIEFIHFADKFARGCFTTLVS-NDMFLKLSP 177

Query: 692 DELNSIILEDEL 727
             L  I+  D+L
Sbjct: 178 KHLAEIVSGDDL 189


>SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 581

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 22/76 (28%), Positives = 34/76 (44%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXX 434
           CD ++  DD    P H+ +L+A SPYF A+FT+ L    Q  + +  +            
Sbjct: 33  CDVLLCVDD-EEIPSHKLVLAASSPYFRAMFTSNLLECTQRTITLYDIDVGALQQIVEYF 91

Query: 435 XXXXIDVTDTNVHELL 482
               I + + NV  LL
Sbjct: 92  YTGKITIDEDNVQFLL 107



 Score = 32.7 bits (71), Expect = 0.40
 Identities = 21/72 (29%), Positives = 32/72 (44%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C + L   +   NCLGI        C ++   A+++ +  F  V    +EFL  P 
Sbjct: 118 VRDFCSEFLAKQICVTNCLGIRALTDSFSCKEIYEAAQKFAVENFSKV-MHCEEFLLQPY 176

Query: 692 DELNSIILEDEL 727
           + L S+I  D L
Sbjct: 177 ESLLSLIELDFL 188


>SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38)
          Length = 518

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 21/78 (26%), Positives = 39/78 (50%)
 Frame = +2

Query: 494 LSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDE 673
           L   P ++  C + ++  +   NCLGI + A +     L++    ++   F+ VA + DE
Sbjct: 118 LFEIPSIVHECGEFIQGEIQIDNCLGIQSLAGQYSLSSLKSKVDDFVCWNFMKVACE-DE 176

Query: 674 FLHLPLDELNSIILEDEL 727
           +  +P D L  I+ +D L
Sbjct: 177 YDMVPPDHLRDILSQDTL 194



 Score = 35.1 bits (77), Expect = 0.075
 Identities = 19/70 (27%), Positives = 27/70 (38%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVTD 461
           G     HR +L+ACSPYF A+ TT       S + +                   + +T 
Sbjct: 47  GEEIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPLHECDPVGVQSIVEYFYSKRLTITK 106

Query: 462 TNVHELLMTA 491
            N+  LL  A
Sbjct: 107 ENIEGLLSAA 116


>SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13)
          Length = 1463

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +3

Query: 255  CDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
            CD  +  ++   F  HR IL+A SPYF ALFT+ +   + +++ ++ V
Sbjct: 1395 CDVTLNVNE-VLFHAHRNILAASSPYFRALFTSEMRENQGNEIKLNNV 1441


>SB_23075| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 354

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 23/81 (28%), Positives = 38/81 (46%)
 Frame = +2

Query: 488 SRLSRFPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQS 667
           S L +F      C D +   +   NCL I+  A R     L+  A   ++  F T   ++
Sbjct: 235 SDLLQFKSAKDACIDFIMRQIETSNCLRILALAERHGLKILKEAAFSVIMDNF-TEVVET 293

Query: 668 DEFLHLPLDELNSIILEDELK 730
           D+F +L   ++  I+L D+LK
Sbjct: 294 DDFKNLSTSQVIDILLRDDLK 314


>SB_38976| Best HMM Match : BACK (HMM E-Value=3.09967e-42)
          Length = 603

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/85 (24%), Positives = 38/85 (44%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXX 425
           S  CD  +  + G  F  HR +L+A S +F  +FT+ +     S + +  + S       
Sbjct: 49  SGFCDVNLEVE-GQVFAAHRCVLAANSQFFYTMFTSGMRDSNDSRIKLCSLTSGALSSIL 107

Query: 426 XXXXXXXIDVTDTNVHELLMTADYL 500
                  I+++  NV ++L  A +L
Sbjct: 108 DFFYTREINISRDNVVDILEAASFL 132



 Score = 33.1 bits (72), Expect = 0.30
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 512 VLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPL 691
           V   C   + S+L   NC+     A +    +L+  A  ++ + F  V ++ +EFL L +
Sbjct: 137 VKSACAQIILSALRINNCISTRRVADKYALEELKIKADSFIKKNFQQVRSE-EEFLDLSI 195

Query: 692 DELNSIILEDEL 727
            EL  +I  D+L
Sbjct: 196 GELCELISSDDL 207


>SB_12977| Best HMM Match : BTB (HMM E-Value=1.7e-30)
          Length = 176

 Score = 34.7 bits (76), Expect = 0.099
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +3

Query: 240 RVSS-ACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI 389
           RVS   CD  ++  D  SFP H+ +L+A S YF A+F        ++DV++
Sbjct: 27  RVSGEGCDVTLKVTD-QSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVVL 76


>SB_44086| Best HMM Match : BTB (HMM E-Value=1.8e-23)
          Length = 417

 Score = 32.7 bits (71), Expect = 0.40
 Identities = 21/76 (27%), Positives = 39/76 (51%)
 Frame = +2

Query: 503 FPGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLH 682
           FPG+ + C  +L+ +L PK+ L ++  A ++    L++     +      V T SD FL 
Sbjct: 113 FPGLKEKCSHYLQENLEPKDVLFVLPEAMKIQDENLQSHCWELIGEKTEEVVT-SDAFLS 171

Query: 683 LPLDELNSIILEDELK 730
           +  + L  I+  D+L+
Sbjct: 172 VTRELLCYILDRDKLR 187


>SB_8489| Best HMM Match : Kelch_1 (HMM E-Value=1.2e-30)
          Length = 619

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 240 RVSS-ACDAIVRADDGASFPVHRAILSACSPYFLALF 347
           RVS   CD  ++  D  SFP H+ +L+A S YF A+F
Sbjct: 69  RVSGEGCDVTLKVTD-QSFPGHKLVLAANSTYFRAMF 104


>SB_49590| Best HMM Match : BTB (HMM E-Value=4.8e-06)
          Length = 89

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGV 398
           S  CD  +  + G   PVHRA+L+A   +F  LF + L    Q  + +  +
Sbjct: 8   SHLCDVSIDVN-GRISPVHRAVLAANEGFFGGLFESNLKENNQDVIHLDAI 57


>SB_13356| Best HMM Match : BACK (HMM E-Value=5.1e-16)
          Length = 1155

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 18/68 (26%), Positives = 31/68 (45%)
 Frame = +2

Query: 524 CCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEFLHLPLDELN 703
           C D L S+++  NC  I   A       L   A R++   F  + + S EF+++   EL 
Sbjct: 745 CLDMLASAISIDNCFKIREIALDYESKGLYKQANRFIRANFSRIVSTSCEFVNVTSAELL 804

Query: 704 SIILEDEL 727
            ++  D +
Sbjct: 805 ELLSSDAI 812


>SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18)
          Length = 123

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = +3

Query: 246 SSACDAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI 389
           S  CD  ++A +      HR +L+A SPYF  L   T + + + + ++
Sbjct: 38  SEHCDITLKAGN-LVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVM 84


>SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +3

Query: 255 CDAIVRADDGASFPVHRAILSACSPYFLALF 347
           CD  +R ++    P H+ +L+A SPYF  LF
Sbjct: 48  CDVTLRHNE-RRIPCHKVVLAARSPYFRHLF 77


>SB_39453| Best HMM Match : BTB (HMM E-Value=3.1e-36)
          Length = 398

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +3

Query: 282 GASFPVHRAILSACSPYFLALFTTTLHSREQS 377
           G  F  H+AIL+A SP F A+F    H  E+S
Sbjct: 231 GREFKAHKAILAARSPVFSAMFE---HEMEES 259


>SB_25077| Best HMM Match : BTB (HMM E-Value=1.4e-10)
          Length = 292

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFT 350
           DA++  D+   F VH A L+  SP F  L T
Sbjct: 59  DAVLTVDNNQKFHVHTATLARVSPVFEELLT 89


>SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1000

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = -1

Query: 283 PSSARTIASQADDTRAVDGAPASLPPTCTDRFPDPP 176
           PS + + +SQ    ++++ AP S PPT  D FP PP
Sbjct: 859 PSRSNSTSSQ----QSIESAPGS-PPTGADDFPPPP 889


>SB_33162| Best HMM Match : EGF (HMM E-Value=1.2e-06)
          Length = 313

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +3

Query: 492 DYLAFLECFSFVAIISEVH*TQKTVLEL*LLQGVFSVTNSKRMHEGIYCV 641
           D+L F ECFS  ++++      K++     L   +  TN KR+H  +  V
Sbjct: 197 DFLVFSECFSVFSVMAPARILVKSLCR---LMTSYRSTNQKRLHADLQFV 243


>SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 850

 Score = 28.3 bits (60), Expect = 8.6
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -1

Query: 232 DGAPASLPPTCTDRFPDPPSDCYLGRFP 149
           DG PA + P     + DP S  Y+ R+P
Sbjct: 629 DGHPAYMDPDGHPAYMDPESQAYMSRYP 656


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,829,479
Number of Sequences: 59808
Number of extensions: 576302
Number of successful extensions: 1513
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 1378
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1505
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2490695009
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -