SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30151.Seq
         (892 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07)             30   2.2  
SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.1  
SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023)               29   5.1  
SB_36184| Best HMM Match : UBA (HMM E-Value=2.4e-09)                   28   8.8  

>SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07)
          Length = 246

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%)
 Frame = +2

Query: 362 PPQQVDFED-EQEMRFVYSVIYDVFR 436
           PP +VDF++ E+  R VYSVIY V R
Sbjct: 5   PPVKVDFKERERTKRIVYSVIYGVGR 30


>SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1913

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 380 FEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLADY 490
           F+D+ E R  YS+ +   RY+ VL+  + D  F + +
Sbjct: 109 FDDDLERRRAYSMAFGAKRYELVLEDVLLDSYFFSSF 145


>SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023)
          Length = 308

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +3

Query: 387 TNKKCVSFILLFMTFSDINVSWTRPWTILSSWLTTHSTPATSHSL 521
           T  +  +F+L    FS I+    +  T+++SW    ST  TSH L
Sbjct: 251 TQGRPYNFLLCRYEFSAISFDVAKSVTVVASWTFVSSTMLTSHCL 295


>SB_36184| Best HMM Match : UBA (HMM E-Value=2.4e-09)
          Length = 1337

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +3

Query: 402 VSFILLFMTFSDINVSWTRPWTILSSWLTTHS-TPATSHSLAIPXGVSETSLGGQTKGRA 578
           V+ +L+ M    ++ SWT      +  LT+ + + ATS +  +  G S T +G +++  +
Sbjct: 681 VTTVLINMINQTLS-SWTEDLYGRADSLTSPAPSAATSSTTLVAAGSSSTLVGSRSRDDS 739

Query: 579 RTRYTTIGKGAGQP 620
            +R  ++  G G P
Sbjct: 740 FSRSVSVESGGGSP 753


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,627,993
Number of Sequences: 59808
Number of extensions: 495242
Number of successful extensions: 1143
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1051
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1142
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2550281014
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -