SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07)             30   2.1  
SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.9  
SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023)               29   4.9  
SB_46626| Best HMM Match : wnt (HMM E-Value=0)                         29   6.5  

>SB_57322| Best HMM Match : DNA_pol_A (HMM E-Value=1.7e-07)
          Length = 246

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 1/26 (3%)
 Frame = +2

Query: 362 PPQQVDFED-EQEMRFVYSVIYDVFR 436
           PP +VDF++ E+  R VYSVIY V R
Sbjct: 5   PPVKVDFKERERTKRIVYSVIYGVGR 30


>SB_48138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1913

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 380 FEDEQEMRFVYSVIYDVFRYKCVLDQAMDDIEFLADY 490
           F+D+ E R  YS+ +   RY+ VL+  + D  F + +
Sbjct: 109 FDDDLERRRAYSMAFGAKRYELVLEDVLLDSYFFSSF 145


>SB_15001| Best HMM Match : Calx-beta (HMM E-Value=0.023)
          Length = 308

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +3

Query: 387 TNKKCVSFILLFMTFSDINVSWTRPWTILSSWLTTHSTPATSHSL 521
           T  +  +F+L    FS I+    +  T+++SW    ST  TSH L
Sbjct: 251 TQGRPYNFLLCRYEFSAISFDVAKSVTVVASWTFVSSTMLTSHCL 295


>SB_46626| Best HMM Match : wnt (HMM E-Value=0)
          Length = 359

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -2

Query: 614 CPAPSNSCVARSCSALGLASQRRLANSIR 528
           C  PS SCV R+CS   L S R ++N ++
Sbjct: 242 CHGPSASCVTRTCSQ-ALPSPRAVSNRLK 269


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,603,671
Number of Sequences: 59808
Number of extensions: 520747
Number of successful extensions: 1271
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1170
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1270
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2479240863
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -