SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_18219| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.6  
SB_14593| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.6  
SB_29174| Best HMM Match : TPR_1 (HMM E-Value=0.55)                    29   4.5  
SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.5  
SB_51436| Best HMM Match : Neuromodulin (HMM E-Value=6.2)              29   4.5  
SB_27454| Best HMM Match : Lipase_GDSL (HMM E-Value=0.091)             29   5.9  
SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024)           29   5.9  
SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36)               28   7.8  
SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.8  

>SB_18219| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +2

Query: 362 QRLCCRTLLQ-KQNRRSNNGKLQTDP 436
           +R+CC TLLQ   NRR N G    DP
Sbjct: 36  ERICCTTLLQCYPNRRINGGDNNQDP 61


>SB_14593| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
 Frame = +2

Query: 362 QRLCCRTLLQ-KQNRRSNNGKLQTDP 436
           +R+CC TLLQ   NRR N G    DP
Sbjct: 21  ERICCTTLLQCYPNRRINGGDNNQDP 46


>SB_29174| Best HMM Match : TPR_1 (HMM E-Value=0.55)
          Length = 420

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +2

Query: 365 RLC-CRTLLQKQNRRSNNGKLQTDPFSGDHCAECL**PGSSAVFSTGKRT 511
           R C  R  ++  N+R N+ + QTD  S  HC +     G SAV  + +RT
Sbjct: 88  RYCEARLQIKATNKRCNSTRRQTDVMSISHCVD-----GYSAVLHSDERT 132


>SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2353

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 312 YDIETTVTVEFDTGQAYRDFVAGPYFRNRIEDQITESYRPTRSPATTVPSA 464
           Y   + ++ E DT     DFV       + + +ITES   T SP TT  SA
Sbjct: 842 YSDTSQISFEDDTPVTEEDFVI---LEKKCQSKITESASDTNSPVTTEDSA 889


>SB_51436| Best HMM Match : Neuromodulin (HMM E-Value=6.2)
          Length = 359

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 312 YDIETTVTVEFDTGQAYRDFVAGPYFRNRIEDQITESYRPTRSPATTVPSA 464
           Y   + ++ E DT     DFV       + + +ITES   T SP TT  SA
Sbjct: 128 YSDTSQISFEDDTPVTEEDFVI---LEKKCQSKITESASDTNSPVTTEDSA 175


>SB_27454| Best HMM Match : Lipase_GDSL (HMM E-Value=0.091)
          Length = 522

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +3

Query: 345 DTGQAYRDFVAGPYFRNRIEDQITESYRPTRSPATTVPSAYDDP 476
           +T  A+   +   YF+  ++   TE   P +SPAT   S Y DP
Sbjct: 274 NTAHAHIAVMIAEYFKEALK---TEQAEPLQSPATLPQSLYSDP 314


>SB_14715| Best HMM Match : Baculo_PEP_C (HMM E-Value=0.0024)
          Length = 2040

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +3

Query: 354  QAYRDFVAGPYFRNRIEDQITESYRPTRSPATTV 455
            Q YR  + G   R+RI+D +  S  P R+P + +
Sbjct: 1418 QEYRSRIEGQVLRSRIQDLVPRSRIPGRAPRSRI 1451


>SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36)
          Length = 704

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/48 (33%), Positives = 20/48 (41%)
 Frame = +3

Query: 348 TGQAYRDFVAGPYFRNRIEDQITESYRPTRSPATTVPSAYDDPDPQLY 491
           T    RDFV G YFR R   ++  +   T S    V   Y   D  L+
Sbjct: 173 TSTPIRDFVPGSYFRGRPSGRLENNPAKTESKECRVTIPYPLIDDDLF 220


>SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1258

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/41 (31%), Positives = 22/41 (53%)
 Frame = +1

Query: 673 KGDTSL*GQFTTFQSGXQPLKPVTILLEAGYNPFKFGKTSL 795
           + D S  G  +TF++G  P+K ++ L   G   ++F   SL
Sbjct: 288 ESDPSTWGDMSTFENGGIPVKTLSKLTSPGAKEYRFDGNSL 328


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,390,919
Number of Sequences: 59808
Number of extensions: 431477
Number of successful extensions: 3310
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3183
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3307
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2263654701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -