SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30147.Seq
         (878 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)             114   1e-25
SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)          103   1e-22
SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                97   2e-20
SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)                 78   8e-15
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.13 
SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)              33   0.23 
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              32   0.53 
SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                    32   0.53 
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               31   1.6  
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     30   2.8  
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   6.6  
SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.6  
SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.7  

>SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)
          Length = 123

 Score =  114 bits (274), Expect = 1e-25
 Identities = 53/95 (55%), Positives = 69/95 (72%), Gaps = 2/95 (2%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQ
Sbjct: 1   MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60

Query: 436 TREHALLAFTLGVKQLIVGVNKMDS--LNHHTVSP 534
           TREHA+L  +LGV QLIV +NK+D   L +H   P
Sbjct: 61  TREHAILVRSLGVTQLIVAINKLDMVVLGYHRGKP 95


>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score =  103 bits (248), Expect = 1e-22
 Identities = 47/113 (41%), Positives = 71/113 (62%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 435
           +++    F+T   + T++DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G  + GQ
Sbjct: 210 VEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGFERGGQ 269

Query: 436 TREHALLAFTLGVKQLIVGVNKMDSLNHHTVSPDLRKSRRKYPHTSRRLGYNP 594
           TREHA+LA T GVK L++ VNKMD            + + K     +++G+NP
Sbjct: 270 TREHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFNP 322



 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 17/40 (42%), Positives = 28/40 (70%)
 Frame = +3

Query: 126 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 245
           Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + ER+
Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERD 205


>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 44/49 (89%), Positives = 46/49 (93%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEM 188
           M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+
Sbjct: 1   MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEV 49


>SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)
          Length = 322

 Score = 78.2 bits (184), Expect = 8e-15
 Identities = 34/36 (94%), Positives = 35/36 (97%)
 Frame = +1

Query: 256 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 363
           IDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ
Sbjct: 25  IDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60



 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 6/74 (8%)
 Frame = +1

Query: 637 NMLEPSTKMPWFKGWQVER------KEGKADGKCLIEALDAILPPARPLTSPCVFPARRI 798
           NM+  +++MPWFK W +ER      KE  A G  L E LD+ILPP+RP   P   P + +
Sbjct: 53  NMITGTSQMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDV 112

Query: 799 XNSVVXVPCPSGRI 840
                    P GR+
Sbjct: 113 YKIGGIGTVPVGRV 126



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +3

Query: 186 MGKGSFKYAWVLDKLKAERE 245
           MGKGSFKYAWVLDKLKAERE
Sbjct: 1   MGKGSFKYAWVLDKLKAERE 20


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 477
           +T ID PGH  F      G +  D  VL+VAA  G      ++  ++  HA+ A      
Sbjct: 78  ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGV----KTQTVESIRHAMHAKV---- 129

Query: 478 QLIVGVNKMD 507
            LIV +NK+D
Sbjct: 130 PLIVAINKID 139


>SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)
          Length = 541

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 18/67 (26%), Positives = 31/67 (46%)
 Frame = +1

Query: 307 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 486
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 69  VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122

Query: 487 VGVNKMD 507
           +  NK+D
Sbjct: 123 ILQNKID 129


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 235 LSVXRYQIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 387
           L+  R Q  +   +F+     + IID PGH  F      G+S  D A+L+V
Sbjct: 659 LNAIRIQTKMVKEEFDIKIPGLLIIDTPGHESFSNLRSRGSSLCDMAILVV 709


>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score = 32.3 bits (70), Expect = 0.53
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +3

Query: 42  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 137
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 12  MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43



 Score = 28.3 bits (60), Expect = 8.7
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 292 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 99  FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 22/85 (25%), Positives = 33/85 (38%)
 Frame = +1

Query: 262 IALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 441
           I  +  +     +  +D PGH  F      G    D  +++VAA             QT+
Sbjct: 128 IGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAADDDVMP-------QTK 180

Query: 442 EHALLAFTLGVKQLIVGVNKMDSLN 516
           E    A   GV  +I  +NK+D  N
Sbjct: 181 EAISHAQAAGV-PIIFAINKIDKPN 204


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 9/35 (25%), Positives = 19/35 (54%)
 Frame = +1

Query: 298 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 402
           + I+D PGH+DF ++     +  D  ++++    G
Sbjct: 81  INILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +3

Query: 57  THINIVVIGHVDSGKSTTTGHLIY 128
           T I + V+G+V+SGKST  G L Y
Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +3

Query: 66   NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 164
            N  ++ HVD GKST    L+   G I K +  K
Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975


>SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1049

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 35/151 (23%), Positives = 59/151 (39%), Gaps = 3/151 (1%)
 Frame = +1

Query: 349  TGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSLNHHTV 528
            TGT+  D  + +     G+F++ ++ N  +    LLA  +G+ +   G+    +++ HT 
Sbjct: 790  TGTNVLDSIISLTPGKIGQFDSSVTMNEDSTSE-LLASIMGLTKTTSGLLVSQTVSTHTT 848

Query: 529  SPDLRKSRRKYPHTSRRLGYNPAAVAFVPIS-GWHGDNM--LEPSTKMPWFKGWQVERKE 699
            +     S  + PH       N    + +P S G  GD +     ST  P F         
Sbjct: 849  ASTGIMSTAE-PHVEE---LNSGISSEMPTSFGGLGDLLSGTSSSTLTPGFFSNSAVTVS 904

Query: 700  GKADGKCLIEALDAILPPARPLTSPCVFPAR 792
                   L+     I     P+TSP + P R
Sbjct: 905  SVVTSDKLLSG--GITSTTSPITSPRLSPIR 933


>SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 476

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = +1

Query: 625 WHGDNMLEPSTKMPWFKGWQVERKE 699
           +H DN    +   PWF+ W  +++E
Sbjct: 191 YHNDNKTHSTQTGPWFRAWSNQKRE 215


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,864,655
Number of Sequences: 59808
Number of extensions: 594816
Number of successful extensions: 1620
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1435
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1615
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2502612210
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -