SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30141.Seq
         (897 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19700| Best HMM Match : No HMM Matches (HMM E-Value=.)             145   5e-35
SB_21580| Best HMM Match : Flotillin (HMM E-Value=0)                   58   7e-09
SB_22284| Best HMM Match : PDT (HMM E-Value=0.18)                      31   1.7  
SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.2  
SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.9  
SB_35332| Best HMM Match : CBM_X (HMM E-Value=2.4)                     29   3.9  
SB_17963| Best HMM Match : RVP (HMM E-Value=0.3)                       29   3.9  
SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.9  
SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.7  
SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.7  
SB_22283| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.7  
SB_17020| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.9  
SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.9  

>SB_19700| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 664

 Score =  145 bits (351), Expect = 5e-35
 Identities = 84/179 (46%), Positives = 103/179 (57%)
 Frame = +3

Query: 255 EVMTLNPMCEYVETAQGVPLTVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTL 434
           EVMTLNP CE VETAQGV +TVTGVAQ K+M E  LL TACEQFLGKT ++I+  VLQTL
Sbjct: 331 EVMTLNPTCEAVETAQGVAVTVTGVAQVKVMTEPRLLKTACEQFLGKTTRQIESVVLQTL 390

Query: 435 EGHLRAILGTLTVEEVYKDRDQFAGWYAKWLRRTSEEWESRFCPSRLRTSTTMSSIWASL 614
           EGHLRAILGTL+VEE+YKDR+ FA    +                 ++          SL
Sbjct: 391 EGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSL 450

Query: 615 GKFATANVKRDAERPCRSG*PRCWY*GSGIEKNAMDVKIFD*HPKLKDNRDSSKFQKGA 791
           GK  TA VKRDA+              +  EK  MDV +++    + D+    + QK A
Sbjct: 451 GKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDV-VYETQTNIADSSREYQMQKAA 508



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 33/48 (68%), Positives = 40/48 (83%)
 Frame = +1

Query: 115 MGNIHTVGPNEALIVSGGCFGPTTKRTIVGGWAWAWCLVTDVQRISLK 258
           MGN +TVGPNEAL+VSGGC G   K+T++GGWA+AW  VTDVQ ISL+
Sbjct: 284 MGNCYTVGPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLE 331


>SB_21580| Best HMM Match : Flotillin (HMM E-Value=0)
          Length = 393

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 1/56 (1%)
 Frame = +3

Query: 327 VAQCKIMNED-ELLTTACEQFLGKTVKEIKMTVLQTLEGHLRAILGTLTVEEVYKD 491
           + Q KI  ++ E+L  AC+QFLGK+ ++ +   L+TLEGH RAI+GT+TVE    D
Sbjct: 63  ILQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEVASSD 118



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +2

Query: 518 EVAAPDVGRMGIEILSFTIKDVYDDVQYLGQ 610
           EVA+ D+  MGI I+S+TIKD+ D+ + + +
Sbjct: 113 EVASSDLVNMGISIVSYTIKDIRDEEEAIAE 143


>SB_22284| Best HMM Match : PDT (HMM E-Value=0.18)
          Length = 773

 Score = 30.7 bits (66), Expect = 1.7
 Identities = 16/52 (30%), Positives = 27/52 (51%)
 Frame = -3

Query: 667 ERHGRSASLFTLAVANFPKLAQILDIVVDVLNREGQNLDSHSSDVRRSHFAY 512
           + HGR+     +  AN P   ++  ++VD  N  G+ L  HS +V   +F+Y
Sbjct: 361 QSHGRNIYEIDVTQAN-PDQDRVNHVIVDASNSPGKILVVHSGNVMEENFSY 411


>SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2388

 Score = 30.3 bits (65), Expect = 2.2
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -2

Query: 221 QAHAHPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPF 102
           QA   PPTM++ +  P  PP  I     P+V + P  NPF
Sbjct: 402 QASIPPPTMIQTLPPPSVPPPPIGVPNRPSV-LYPNNNPF 440


>SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1023

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 737 LTPKIEGQQRLFKISERRHFDSRNLNXSLKRERAFWXYXLSSQRKI 874
           +T K+E QQ++ +  +RR      LN  L+  R F  Y  S Q KI
Sbjct: 2   ITEKLEKQQKMEQERKRRQKHQEYLNMILQHARDFKEYHRSVQSKI 47


>SB_35332| Best HMM Match : CBM_X (HMM E-Value=2.4)
          Length = 400

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/44 (27%), Positives = 25/44 (56%)
 Frame = -3

Query: 616 PKLAQILDIVVDVLNREGQNLDSHSSDVRRSHFAYQPANWSLSL 485
           P   ++  ++VD  N  G+ L  HS +V+  +F+Y+    ++S+
Sbjct: 197 PDQDRVNHVIVDASNSPGKILVVHSGNVKEENFSYRDKTLTISM 240


>SB_17963| Best HMM Match : RVP (HMM E-Value=0.3)
          Length = 338

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 15/68 (22%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +3

Query: 219 LVSGYGRPTYIPEVMTLNPMCEYVETAQGVPLTVTGVAQCKIMN--EDELLTTA-CEQFL 389
           + +  G P ++   ++++  C + +T   V + +  +   KI+N  + E+ +TA  E + 
Sbjct: 213 ITTASGEPLHVHGTVSIDITCAWQDTHMNVMIPIPIILALKILNRTKSEISSTARSESYT 272

Query: 390 GKTVKEIK 413
           G+T+ E++
Sbjct: 273 GQTLCELR 280


>SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 824

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 4/54 (7%)
 Frame = -2

Query: 347 HDLALGDSGHRE--RHSLGRFNVLAHRVQCH--HFRDIRWTSVTRHQAHAHPPT 198
           HD  L D+   E  RH    ++   H    H  H  D+     TRH  H H  T
Sbjct: 476 HDTHLHDTHTHETTRHDTHLYDTHTHETTRHDTHLHDMHTHETTRHDTHLHDTT 529


>SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4856

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 11/25 (44%), Positives = 18/25 (72%)
 Frame = -3

Query: 94   LSRYTHCTSQLKR*QTCLIYRKINK 20
            L   T C S+++R Q+C++ +KINK
Sbjct: 1401 LKNITVCDSEVERQQSCMVSQKINK 1425


>SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4529

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 1/80 (1%)
 Frame = +1

Query: 1    CHCCFYIY*FFGKLNKFVIVLVVKCSVC-IVKVTVKGFKMGNIHTVGPNEALIVSGGCFG 177
            C  CF+ Y    K+NK ++    +C  C + +   KG     +      + +     C  
Sbjct: 773  CGQCFHPYCVGVKVNKMILSKGWRCLDCTLCEGCGKGSDEARLLLCDSCD-ISYHTYCLD 831

Query: 178  PTTKRTIVGGWAWAWCLVTD 237
            P  ++   GGW   WC+  D
Sbjct: 832  PPLEKVPPGGWKCKWCVSCD 851


>SB_22283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 446

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = -3

Query: 616 PKLAQILDIVVDVLNREGQNLDSHSSDVRRSHFAYQPANWSLSL 485
           P   ++  ++VD  N  G+ L  HS +V+  +F+Y+     +S+
Sbjct: 221 PDQDRVNHVIVDASNSPGKILVVHSGNVKEENFSYRDKTLMISM 264


>SB_17020| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 957

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -1

Query: 660 TDVQRPSSRWPLRTSPSWPRYWTSS*TSLIVKDRISIPIL 541
           +D  +P S  P R SPS+  +W S   SLI    I  P+L
Sbjct: 50  SDTFQPFSVKPRRESPSFAEHWISLLESLIRLQVIDEPVL 89


>SB_8773| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 424

 Score = 28.3 bits (60), Expect = 8.9
 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = -2

Query: 365 EKFVFVHDLALGDSGHRERHSLGRFNVL--AHRVQCHHFRDIRWTS 234
           EK V    L L D GHR +HSL   N L   H    H     R T+
Sbjct: 52  EKCVSALKLNLRDQGHRNKHSLSPPNALMATHNASSHESHINRTTT 97


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,154,734
Number of Sequences: 59808
Number of extensions: 694925
Number of successful extensions: 1948
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1745
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1942
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2574115416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -