SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30139.Seq
         (697 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.)               53   2e-07
SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42)               48   5e-06
SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23)                   48   7e-06
SB_8088| Best HMM Match : UCH (HMM E-Value=1.1e-20)                    46   2e-05
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   2e-05
SB_21866| Best HMM Match : UCH (HMM E-Value=0)                         46   4e-05
SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10)                43   2e-04
SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07)                   41   8e-04
SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06)                   38   0.010
SB_47787| Best HMM Match : DUF1556 (HMM E-Value=3.4)                   37   0.018
SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.031
SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13)                      36   0.031
SB_8927| Best HMM Match : UCH (HMM E-Value=0)                          35   0.055
SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.13 
SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.39 
SB_40551| Best HMM Match : Extensin_2 (HMM E-Value=0.076)              32   0.51 
SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25)          30   1.6  
SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)                   30   1.6  
SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     29   4.8  
SB_93| Best HMM Match : No HMM Matches (HMM E-Value=.)                 29   4.8  
SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0)                   28   8.3  

>SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
           +LQD L  F + + L+GDN Y C +C K R  VK   I  LP VL + LKRF ++
Sbjct: 151 NLQDSLEQFVNGEILEGDNAYFCEKCNKRRTTVKRMCIKTLPPVLVIQLKRFGYD 205


>SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42)
          Length = 1712

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 309  VSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
            + LQDCL  F   +EL  ++++ CS C   R   K   +   P  L VHLKR+RH
Sbjct: 1000 LQLQDCLRTFVDREEL--EDLWPCSMCNAQRTATKSLSVCRFPDTLIVHLKRYRH 1052


>SB_52467| Best HMM Match : UCH (HMM E-Value=2.6e-23)
          Length = 422

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRH 473
           VV L DC+  F + ++L  ++ + C +CKK +   K   +  LP VL +HLKRF +
Sbjct: 245 VVQLNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSY 300


>SB_8088| Best HMM Match : UCH (HMM E-Value=1.1e-20)
          Length = 379

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE-LLFS 488
           +L++C+  F   + L  D+ + C +CKK R   K   +  LP  L +HLKRF  + +LF 
Sbjct: 255 TLRECVELFTEPETLGEDDAWHCPKCKKHREATKQMSLWRLPDTLIIHLKRFSFKNILFR 314

Query: 489 AKV 497
            K+
Sbjct: 315 DKI 317



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           SII D+F G+L S + C +C  +S + + F +LS+P+P    L
Sbjct: 69  SIIVDMFQGQLKSKLTCPVCKTISIKYDPFMNLSVPLPKENKL 111


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +3

Query: 303 PVVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHEL 479
           P +SL++ L  FF  + L+G N Y C RC+ L++  +   I   P  L + LKRF + +
Sbjct: 712 PSISLEEMLGYFFEPEMLEGSNQYHCERCQGLQDAERSVVIANAPMFLVLTLKRFSYNV 770



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 23/60 (38%), Positives = 31/60 (51%)
 Frame = +1

Query: 19  RAKSGSSGDGSNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLA 198
           R+ SG+ G G ++   +II D F G+L+    C  C  VS R E F DL L  P +   A
Sbjct: 581 RSMSGA-GLGQDM-ISNIIEDTFSGRLIVCHSCRRCRHVSCREEAFTDLPLAFPHQRDAA 638


>SB_21866| Best HMM Match : UCH (HMM E-Value=0)
          Length = 2165

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = +3

Query: 312  SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHE 476
            SL D +  F   D L+G N Y C +C K  + VK   I  LP V+ + LKRF ++
Sbjct: 1452 SLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTVKRMCISKLPRVMAIQLKRFDYD 1506


>SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10)
          Length = 1303

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = +1

Query: 64  RSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           +SII D+F G+L S V+C+ C  VS R + F  LSLP+P
Sbjct: 496 QSIIVDLFQGQLKSQVRCVECGYVSARFDPFTFLSLPLP 534


>SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2708

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/49 (38%), Positives = 27/49 (55%)
 Frame = +3

Query: 348  DELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRFRHELLFSAK 494
            D L GDNMY+CS+C K     K +   VLP +LC +  R+   ++   K
Sbjct: 1288 DTLDGDNMYTCSQCGKKVRAEKRACFTVLPRILCFNTMRYTFNMVTMMK 1336


>SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07)
          Length = 711

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 14/37 (37%), Positives = 25/37 (67%)
 Frame = +1

Query: 67  SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPI 177
           +I+ ++F G+L+   +CL C+    R E FQD+S+P+
Sbjct: 118 NIVEEMFQGRLVHETKCLTCENAKQRFEDFQDVSVPV 154



 Score = 34.7 bits (76), Expect = 0.072
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           +L+  ++ F + + LK +N Y C  C         +   +LP VL +HLKRF
Sbjct: 183 TLEWAISQFATVEVLKDNNKYFCENCCTYTEARLSTFFDLLPQVLTLHLKRF 234


>SB_29469| Best HMM Match : UCH (HMM E-Value=6.7e-06)
          Length = 757

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           SL  C+  F   ++L  DN Y C++C+  ++  +   +  LP VL + L RF
Sbjct: 136 SLNQCIKEFLKEEKLDCDNQYFCTQCQSKQDARRYIELKHLPPVLNLQLLRF 187


>SB_47787| Best HMM Match : DUF1556 (HMM E-Value=3.4)
          Length = 382

 Score = 36.7 bits (81), Expect = 0.018
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = +1

Query: 76  SDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIP 180
           SD+F G L S + CL C   S   + F DLSLPIP
Sbjct: 347 SDLFVGVLKSTLICLECGFKSVTFDPFWDLSLPIP 381


>SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2578

 Score = 35.9 bits (79), Expect = 0.031
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +1

Query: 67   SIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSR 186
            S + D+F  +  SA+ C  C + ST  + F  LSLPIP R
Sbjct: 2096 SFVLDLFQAQYRSALSCPKCKQKSTTFDPFLCLSLPIPQR 2135


>SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13)
          Length = 969

 Score = 35.9 bits (79), Expect = 0.031
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKKLRNG 407
           S+  CL+ F + + L G N ++C  C K RNG
Sbjct: 701 SVMSCLSVFCAKETLTGKNKFACEECTKARNG 732


>SB_8927| Best HMM Match : UCH (HMM E-Value=0)
          Length = 316

 Score = 35.1 bits (77), Expect = 0.055
 Identities = 14/46 (30%), Positives = 29/46 (63%)
 Frame = +1

Query: 73  ISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRC 210
           + ++F G L +  +CL C+ VS++ E+F DLS+ +   ++ ++  C
Sbjct: 205 VHEMFEGTLTNETRCLCCESVSSKDESFLDLSVDV--EQNTSITHC 248


>SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 229

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +3

Query: 312 SLQDCLAAFFSADELKGDNMYSCSRCKK 395
           +LQD L  F + + L+GDN Y C +C K
Sbjct: 159 NLQDSLEQFVNGEILEGDNAYFCEKCNK 186


>SB_47601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 652

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 22/58 (37%), Positives = 29/58 (50%)
 Frame = +3

Query: 57  EVPKHHIRRVRXEVTISRSVPNM*QGINENRNIPRLVAADPVPGTLGRAALPAAHAEP 230
           EVPK H RR     T+SRS P   +GI+E   +  ++A +PV    G A    A   P
Sbjct: 22  EVPKSHRRRP----TVSRSRPKPDEGISEAVEVDIVIAGEPVTVDGGVAKTREAKPSP 75


>SB_40551| Best HMM Match : Extensin_2 (HMM E-Value=0.076)
          Length = 1269

 Score = 31.9 bits (69), Expect = 0.51
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +3

Query: 162 LVAADPVPGTLGRAALPAAHAEPPRGPQRTG 254
           +V  DP+P T   AA PA +A PP GP + G
Sbjct: 709 MVHYDPMPQTSNPAARPAFYAVPPGGPVQFG 739


>SB_52114| Best HMM Match : Galactosyl_T (HMM E-Value=3.5e-25)
          Length = 383

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +1

Query: 49  SNVKYRSIISDVFXGKLLSAVQCLICDRVSTRIETFQDLSLPIPSREHLAVLRCQQ--PM 222
           S +K+R++  +   G +L+ + CL  + VSTRI+ + +  L  P R      RC Q   +
Sbjct: 6   STLKHRNLPDENAVGLVLNKLLCL--NTVSTRIKRYHNFPLIGPIRLRQGCQRCSQMSSI 63

Query: 223 LNHHAA 240
           ++H A+
Sbjct: 64  VSHDAS 69


>SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)
          Length = 2049

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = -3

Query: 629  CPAAYRAHVADHRXQRVPRXGTRCTLC 549
            CP AY  H A    +RVPR    C +C
Sbjct: 1745 CPLAYHVHCAYPPLRRVPRGNWACQVC 1771


>SB_43213| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 919

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +3

Query: 306 VVSLQDCLAAFFSADELKGDNMYSCSRCKKLRNGVKLSGIVVLPXVLCVHLKRF 467
           V  ++D L      +EL+G   ++CS+     +  +     VLP VL +HLKRF
Sbjct: 524 VSCIEDALNHLTVKEELQG---FTCSKTNAQIDVSRRVSFEVLPKVLILHLKRF 574


>SB_24189| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1220

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +1

Query: 100 LSAVQCLICDRVSTRIETFQDLSLPIPSREHL 195
           +S ++C   D VSTR+E F D+ L +  ++++
Sbjct: 355 VSYIKCTKVDYVSTRLEPFYDIQLNVKGKKNI 386


>SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 757

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 7/32 (21%)
 Frame = +3

Query: 321 DCLAAFFSADELK-------GDNMYSCSRCKK 395
           DC AAFF+A ELK       G+  Y+C  C K
Sbjct: 614 DCDAAFFAAHELKKHSRRHTGEKPYACVNCNK 645


>SB_93| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 530

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%)
 Frame = +1

Query: 316 CKTVWPP-SSAPTNSKAT 366
           C TVWPP +S+PTN  AT
Sbjct: 2   CATVWPPTTSSPTNYTAT 19


>SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0)
          Length = 1283

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 22/72 (30%), Positives = 27/72 (37%)
 Frame = +3

Query: 9    EFGTSKKRFIRRRQQREVPKHHIRRVRXEVTISRSVPNM*QGINENRNIPRLVAADPVPG 188
            E   S+KR  R        KH +  V     +   V    Q   EN N    V A P   
Sbjct: 999  EHSPSRKR--RNSDNHGHKKHSLTGVSLPSVVEVKVKPASQSAEENENDVTEVRASPSKC 1056

Query: 189  TLGRAALPAAHA 224
            T+GR +   AHA
Sbjct: 1057 TMGRQSKLVAHA 1068


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,667,580
Number of Sequences: 59808
Number of extensions: 344967
Number of successful extensions: 1068
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 954
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1067
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1817559367
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -