SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30137.Seq
         (875 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11)             97   2e-20
SB_11248| Best HMM Match : LMP (HMM E-Value=0.18)                      37   0.019
SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31)                  35   0.075
SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.17 
SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.2  
SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06)              31   1.6  
SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43)                    30   2.1  
SB_43914| Best HMM Match : IRK (HMM E-Value=5.3)                       30   2.8  
SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27)        29   4.9  
SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.5  
SB_17142| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.5  

>SB_32795| Best HMM Match : tRNA_anti (HMM E-Value=4.8e-11)
          Length = 305

 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 43/60 (71%), Positives = 51/60 (85%)
 Frame = +1

Query: 511 WVHRLRRQGKSLAFLTLRDGTGYLQCVLHGLLCQTYNALVLSTESSVVLYGKLEAVPEGK 690
           WVHRLRRQGK+L F+ LRDGTG+LQCVL  +LC TY ALVL TE++V LYG ++AVPEGK
Sbjct: 191 WVHRLRRQGKNLMFVVLRDGTGFLQCVLTDVLCHTYEALVLCTEATVCLYGVVKAVPEGK 250



 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           SK + + ++  AK+QLKK  K++ +E  K+ ++ K E E  ++R +NL++A+ I ++ D 
Sbjct: 106 SKAEGERFEKIAKAQLKKATKLYQQEKRKSEEREKKEAEKAQQREKNLEDARNITIKPDE 165

Query: 437 SLPKATVVKICETTEHRGQRICI 505
           SLP A  +KI +TT+ R QR+ I
Sbjct: 166 SLPVAKQIKIRDTTDCREQRVKI 188


>SB_11248| Best HMM Match : LMP (HMM E-Value=0.18)
          Length = 442

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 26/109 (23%), Positives = 46/109 (42%)
 Frame = +2

Query: 185 ETIQDNIESNASCWQRAISHNLCYSKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKA 364
           +TI++N+E+     +  +S   C  +D      V+  S    +Q I  R+  +  +  + 
Sbjct: 41  KTIKENVETELQKVKEQLSDQACQLEDPVSS--VSRVSYFVTVQAIQTRDAERIAEITRL 98

Query: 365 EEENTEKRSQNLDEAKKILLQEDPSLPKATVVKICETTEHRGQRICIRD 511
           EEE  EK  + LDE  K +      L         E  +H+G +  + D
Sbjct: 99  EEE-LEKSQKGLDELNKQITDMTRELQDTQTRLEAEKQDHQGDKTQLED 146


>SB_24178| Best HMM Match : FARP (HMM E-Value=6.1e-31)
          Length = 721

 Score = 35.1 bits (77), Expect = 0.075
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +2

Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVVKICETTEH 484
           KI+KI V  ++K        +    K     D + +KI +  D  + K  + KIC T+ H
Sbjct: 113 KIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICIWKICVTSNH 172

Query: 485 RGQRICI 505
           + ++IC+
Sbjct: 173 KIRKICV 179



 Score = 29.1 bits (62), Expect = 4.9
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 7/84 (8%)
 Frame = +2

Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVV------KI 466
           K +KI V  ++K        +    K     D + +KI +  D  + K  V       KI
Sbjct: 91  KFRKICVTSDHKIRKICVTSDNKIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKI 150

Query: 467 CETTEHRGQRICIRDGYIVSGAKV 538
           C T++H+ ++ICI    + S  K+
Sbjct: 151 CVTSDHKIRKICIWKICVTSNHKI 174



 Score = 28.7 bits (61), Expect = 6.5
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%)
 Frame = +2

Query: 308 KIQKIWVRENYKAMDKAKAEEENTEKRSQNLD-EAKKILLQEDPSLPKATVVKICETTEH 484
           KI+KI V  ++K        +    K     D + +KI + +        + KIC T++H
Sbjct: 124 KIRKICVTSDHKIRKICVTSDHKIRKICVTSDHKIRKICIWKICVTSNHKIRKICVTSDH 183

Query: 485 RGQRICI 505
           + ++ICI
Sbjct: 184 KIRKICI 190


>SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 672

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 5/95 (5%)
 Frame = +2

Query: 266 DTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLP 445
           DT  Y    + QLK  +++ V+E         +E+E  EK  +  DE  K+  Q + S P
Sbjct: 300 DTPHYLKDKRIQLKGDEEVKVKELLAKAGTKGSEDEEDEKEQEKDDEGPKLQKQVETSKP 359

Query: 446 -----KATVVKICETTEHRGQRICIRDGYIVSGAK 535
                  TV K+ E  E+   R     G  ++G K
Sbjct: 360 GEEQEMVTVTKVVEEIEYTIHRDTKGLGINIAGGK 394


>SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2309

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 18/82 (21%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
 Frame = +2

Query: 278  YDVAAKSQLKKIQKIWVRENYK----AMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLP 445
            Y   AK Q+ K  K+  R   +    +MD+   EE +T +  ++  + K+ +      LP
Sbjct: 1682 YGFTAKGQVAKDLKLGKRRRERRGEESMDEDSCEETDTNETRESTKKMKESMTASPDGLP 1741

Query: 446  KATVVKICETTEHRGQRICIRD 511
             +   K+C+   +R ++  +++
Sbjct: 1742 DSPKEKMCDGRNNRKKKESLKE 1763


>SB_10638| Best HMM Match : Myosin_N (HMM E-Value=1.5e-06)
          Length = 1977

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +2

Query: 269 TKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKK 415
           ++ Y      QL+K+++    E+ +  D+A+     T KR +NL+E KK
Sbjct: 195 SEKYKSIQSEQLEKLKEQTRPESEELRDRARQLSRETNKRRKNLEEKKK 243


>SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1045

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 335 NYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           NY  +D++K  +EN   ++     AKKI ++E+P
Sbjct: 282 NYTEVDESKPADENKNDKTDGAKTAKKINIKENP 315


>SB_19407| Best HMM Match : SURF6 (HMM E-Value=0.43)
          Length = 443

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = +2

Query: 293 KSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDPSLPK 448
           +SQ +++QKIW     +A     AE +   +++Q+L E KKI  ++  S P+
Sbjct: 368 RSQKRRVQKIW---RLRAGVLQAAEMKKKRQKAQSLAERKKIKKEKKKSNPR 416


>SB_43914| Best HMM Match : IRK (HMM E-Value=5.3)
          Length = 141

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 10/28 (35%), Positives = 16/28 (57%)
 Frame = -1

Query: 239 KWLFASMMHCFQYCLEWFLFRTITCIVI 156
           KW +  ++ C  Y L W LF TI  +++
Sbjct: 103 KWHWVILLFCVSYILSWVLFGTIWWLIV 130


>SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27)
          Length = 228

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = +2

Query: 257 SKDDTKDYDVAAKSQLKKIQKIWVRENYKAMDKAKAEEENTEKRSQNLDEAKKILLQEDP 436
           S+D  K+ ++A K    K +K+      K ++K  AEEE  +K  ++ D  K    ++  
Sbjct: 85  SQDTKKEGEMAEKKAKAKERKL-----QKQLEKEAAEEEKVKKPKKSRDGEKTKKSKKVT 139

Query: 437 SLPKATVVK 463
           S PK+  VK
Sbjct: 140 SEPKSPKVK 148


>SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 853

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 3/45 (6%)
 Frame = +2

Query: 260 KDDTKDYDVAA---KSQLKKIQKIWVRENYKAMDKAKAEEENTEK 385
           +DDTK+ D AA   K++L++ + + VRE + +  +A   +E+ E+
Sbjct: 271 EDDTKEVDAAAAADKARLQRSKSLKVREGFSSAWEAIRVKESVER 315


>SB_17142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 173

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
 Frame = -2

Query: 832 HXGSLXAYGLIARQARLPH*GWR-RTTWWCESNQFPSNQLSAHDHPEPSFPR 680
           H G L A  L+ +   +   GW  R+ W C+   +P N    +   +  FPR
Sbjct: 49  HQGFLAAVKLVHKSGYVSCAGWSYRSHWGCKGLAYPLNMFVTNAKNQVIFPR 100


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,233,163
Number of Sequences: 59808
Number of extensions: 575013
Number of successful extensions: 1562
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1383
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1545
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2490695009
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -