SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30136.Seq
         (884 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   7e-08
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     53   4e-07
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               51   1e-06
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              50   2e-06
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           50   2e-06
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       50   2e-06
SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   2e-06
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          50   2e-06
SB_32525| Best HMM Match : DED (HMM E-Value=0.81)                      50   3e-06
SB_44498| Best HMM Match : BA14K (HMM E-Value=7)                       49   4e-06
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   6e-06
SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   6e-06
SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   6e-06
SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   8e-06
SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08)                   48   8e-06
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           48   1e-05
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          48   1e-05
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           48   1e-05
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   48   1e-05
SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    48   1e-05
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)                      48   1e-05
SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)                48   1e-05
SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         48   1e-05
SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)              48   1e-05
SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)                     48   1e-05
SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8)                     48   1e-05
SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_23850| Best HMM Match : SMP (HMM E-Value=4.9)                       48   1e-05
SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015)                    48   1e-05
SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6)             48   1e-05
SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9)                 48   1e-05
SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6)                 48   1e-05
SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5)                 48   1e-05
SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9)           48   1e-05
SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16189| Best HMM Match : rve (HMM E-Value=0.3)                       48   1e-05
SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21)                 48   1e-05
SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3)                   48   1e-05
SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12434| Best HMM Match : SAB (HMM E-Value=4.6)                       48   1e-05
SB_12355| Best HMM Match : IncA (HMM E-Value=2)                        48   1e-05
SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023)           48   1e-05
SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71)                   48   1e-05
SB_7630| Best HMM Match : CAT (HMM E-Value=0)                          48   1e-05
SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_4868| Best HMM Match : BA14K (HMM E-Value=10)                       48   1e-05
SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9)                       48   1e-05
SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.)                48   1e-05
SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.)                48   1e-05
SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.)                48   1e-05
SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.)                48   1e-05
SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.)                48   1e-05
SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.)                 48   1e-05
SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59172| Best HMM Match : SecG (HMM E-Value=9.5)                      48   1e-05
SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5)                   48   1e-05
SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07)                   48   1e-05
SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08)                   48   1e-05
SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1)                    48   1e-05
SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7)              48   1e-05
SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9)                  48   1e-05
SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7)                      48   1e-05
SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5)                    48   1e-05
SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8)                   48   1e-05
SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7)              48   1e-05
SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4)                       48   1e-05
SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98)                  48   1e-05
SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5)           48   1e-05
SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_36577| Best HMM Match : CC (HMM E-Value=7.9)                        48   1e-05
SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33777| Best HMM Match : BTP (HMM E-Value=8.9)                       48   1e-05
SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63)                    48   1e-05
SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28658| Best HMM Match : I-set (HMM E-Value=1.5)                     48   1e-05
SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0)                    48   1e-05
SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3)                      48   1e-05
SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7)                   48   1e-05
SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5)                    48   1e-05
SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3)                   48   1e-05
SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5)                     48   1e-05
SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07)            48   1e-05
SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47)                    48   1e-05
SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31)                     48   1e-05
SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3)             48   1e-05
SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5)              48   1e-05
SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1)                48   1e-05
SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2)                   48   1e-05
SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3)              48   1e-05
SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6)                     48   1e-05
SB_7695| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7672| Best HMM Match : 7tm_1 (HMM E-Value=0.48)                     48   1e-05
SB_7569| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08)                    48   1e-05
SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7229| Best HMM Match : Neurokinin_B (HMM E-Value=7.9)               48   1e-05
SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6806| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6786| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6663| Best HMM Match : DUF1502 (HMM E-Value=5.7)                    48   1e-05
SB_6528| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2)                     48   1e-05
SB_6371| Best HMM Match : PSI_PsaJ (HMM E-Value=2.6)                   48   1e-05
SB_6347| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6048| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_6044| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05

>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 30/58 (51%), Positives = 34/58 (58%)
 Frame = -3

Query: 822 SRXPQLLGKGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           S+  QLLG+       +   PAG KG V    LK G  +GFPSHDVV RRP  CNTTH
Sbjct: 41  SQAAQLLGRAIGAGLFAIT-PAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTH 97


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 55.2 bits (127), Expect = 7e-08
 Identities = 24/38 (63%), Positives = 28/38 (73%)
 Frame = -3

Query: 762 PAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           PAG +G    + +K GNA+GFPSHDVV RRP  CNTTH
Sbjct: 18  PAGERGMC-CKAIKLGNAKGFPSHDVVKRRPVNCNTTH 54


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 28/57 (49%), Positives = 33/57 (57%)
 Frame = -3

Query: 819 RXPQLLGKGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           R  QLLG+       +   PAG +G    + +K GNARGFPSHD   RRP  CNTTH
Sbjct: 39  RVAQLLGRSIGAGLFAIT-PAGERGMC-CKAIKLGNARGFPSHDGEKRRPVNCNTTH 93


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/50 (56%), Positives = 30/50 (60%)
 Frame = -3

Query: 798 KGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           +G+ VRA S       KG   ARRL W    GFPSHDVV RRP  CNTTH
Sbjct: 28  EGRSVRASSLLRQLA-KGGCAARRLSWVTP-GFPSHDVVKRRPVNCNTTH 75


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 27/54 (50%), Positives = 32/54 (59%)
 Frame = -3

Query: 810 QLLGKGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           QLLG+       +   PAG +G    + +K GNA  FPSHDVV RRP  CNTTH
Sbjct: 11  QLLGRAIGAGLFAIT-PAGERGMC-CKAIKLGNASVFPSHDVVKRRPVNCNTTH 62


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 28/50 (56%), Positives = 30/50 (60%)
 Frame = -3

Query: 798 KGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           +G+ VRA S       KG   ARRL WG    FPSHDVV RRP  CNTTH
Sbjct: 599 EGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRRPVNCNTTH 643


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/38 (60%), Positives = 26/38 (68%)
 Frame = -3

Query: 762 PAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           PAG +G    + +K GNA  FPSHDVV RRP  CNTTH
Sbjct: 12  PAGERGMC-CKAIKLGNASVFPSHDVVKRRPVNCNTTH 48


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 28/50 (56%), Positives = 30/50 (60%)
 Frame = -3

Query: 798 KGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           +G+ VRA S       KG   ARRL WG    FPSHDVV RRP  CNTTH
Sbjct: 42  EGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRRPVNCNTTH 86


>SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 27/44 (61%), Positives = 27/44 (61%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF   GN
Sbjct: 41  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFTSWGN 83


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 28/50 (56%), Positives = 30/50 (60%)
 Frame = -3

Query: 798 KGQPVRAXSANYPAGRKGXVPARRLKWGNARGFPSHDVVXRRPRECNTTH 649
           +G+ VRA S       KG   ARRL WG    FPSHDVV RRP  CNTTH
Sbjct: 42  EGRSVRASSLLRQLA-KGGCAARRLSWG----FPSHDVVKRRPVNCNTTH 86


>SB_32525| Best HMM Match : DED (HMM E-Value=0.81)
          Length = 372

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 26/46 (56%), Positives = 26/46 (56%)
 Frame = +3

Query: 630 GTQFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           G    PSESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  GKDMMPSESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 70


>SB_44498| Best HMM Match : BA14K (HMM E-Value=7)
          Length = 146

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 25/40 (62%), Positives = 26/40 (65%)
 Frame = +3

Query: 648 SESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           SESYY   AV LQRRDWENPG    L  L+AH PFG   N
Sbjct: 22  SESYYNSLAVVLQRRDWENPG-VTQLNRLEAHPPFGSWRN 60


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/40 (62%), Positives = 25/40 (62%)
 Frame = +3

Query: 648 SESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           SESYY   AV LQRRDWENPG    L  L AH PF   GN
Sbjct: 60  SESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWGN 98


>SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 222

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/40 (62%), Positives = 25/40 (62%)
 Frame = +3

Query: 648 SESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           SESYY   AV LQRRDWENPG    L  L AH PF   GN
Sbjct: 124 SESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWGN 162


>SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 25/40 (62%), Positives = 25/40 (62%)
 Frame = +3

Query: 648 SESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           SESYY   AV LQRRDWENPG    L  L AH PF   GN
Sbjct: 22  SESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWGN 60


>SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 26/44 (59%), Positives = 27/44 (61%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF +  N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFARWRN 96


>SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08)
          Length = 215

 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 26/44 (59%), Positives = 27/44 (61%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF +  N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFARWRN 96


>SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 24  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 66


>SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 51  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 93


>SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 59  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 101


>SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 35  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 77


>SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 42  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 84


>SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 58  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 100


>SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 46  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 88


>SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 72  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 114


>SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 92  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 134


>SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)
          Length = 295

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 174


>SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 49  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 91


>SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 62  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 104


>SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 45  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 87


>SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 160

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 58  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 100


>SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 90  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 132


>SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 34  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 76


>SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 44  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 86


>SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 57  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 99


>SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)
          Length = 174

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 142


>SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)
          Length = 157

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 56  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 98


>SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 38  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 80


>SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 150 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 192


>SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 41  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 83


>SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 30  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 72


>SB_51427| Best HMM Match : DUF855 (HMM E-Value=4)
          Length = 301

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 98  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 140


>SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 84  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 126


>SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 32  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 74


>SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 178


>SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 44  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 86


>SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 46  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 88


>SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 45  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 87


>SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 324

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 157


>SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 259

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 199


>SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 72  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 114


>SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 46  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 88


>SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 30  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 72


>SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5)
          Length = 180

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 78  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 120


>SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 862

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 494


>SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 102

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 28  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 70


>SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 91  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 133


>SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 56  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 98


>SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 78  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 120


>SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 36  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 78


>SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 59  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 101


>SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 61  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 103


>SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 36  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 78


>SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 224

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 165


>SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 243

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 211


>SB_34190| Best HMM Match : MAM (HMM E-Value=0)
          Length = 384

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 66  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 108


>SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 42  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 84


>SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28)
          Length = 331

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 229 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 271


>SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 99  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 141


>SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 34  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 76


>SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 34  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 76


>SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 178

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 76  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 118


>SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 66  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 108


>SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 51  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 93


>SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038)
          Length = 163

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 61  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 103


>SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 58  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 100


>SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8)
          Length = 204

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 102 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 144


>SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 41  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 83


>SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 29  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 71


>SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 126 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 168


>SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_23850| Best HMM Match : SMP (HMM E-Value=4.9)
          Length = 163

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 61  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 103


>SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015)
          Length = 504

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 174


>SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6)
          Length = 195

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 93  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 135


>SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9)
          Length = 261

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 159 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 201


>SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6)
          Length = 136

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 35  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 77


>SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5)
          Length = 169

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 67  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 109


>SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 112 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 154


>SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9)
          Length = 460

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 249 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 291



 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 24/40 (60%), Positives = 24/40 (60%)
 Frame = +3

Query: 648 SESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           SESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 362 SESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 400


>SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 80  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 122


>SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 35  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 77


>SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 37  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 79


>SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 219

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 117 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 159


>SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 63  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 105


>SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 38  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 80


>SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 32  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 74


>SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 63  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 105


>SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 85  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 127


>SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 84  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 126


>SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 40  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 82


>SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 32  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 74


>SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 62  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 104


>SB_16189| Best HMM Match : rve (HMM E-Value=0.3)
          Length = 595

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 493 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 535


>SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21)
          Length = 791

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 118 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 160


>SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 77  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 119


>SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 38  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 80


>SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 42  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 84


>SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3)
          Length = 177

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 75  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 117


>SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVFLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 93  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 135


>SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 178

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 76  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 118


>SB_12434| Best HMM Match : SAB (HMM E-Value=4.6)
          Length = 160

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 58  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 100


>SB_12355| Best HMM Match : IncA (HMM E-Value=2)
          Length = 225

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 165


>SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 55  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 97


>SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 33  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 75


>SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 30  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 72


>SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023)
          Length = 271

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 211


>SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 199

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 97  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 139


>SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71)
          Length = 439

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 250 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 292


>SB_7630| Best HMM Match : CAT (HMM E-Value=0)
          Length = 285

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 41  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 83


>SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 53  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 95


>SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 27  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 69


>SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 46  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 88


>SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 111 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 153


>SB_4868| Best HMM Match : BA14K (HMM E-Value=10)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 35  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 77


>SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 55  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 97


>SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 58  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 100


>SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 34  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 76


>SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 89  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 131


>SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 55  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 97


>SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 81  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 123


>SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9)
          Length = 188

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 48  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 90


>SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 38  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 80


>SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 32  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 74


>SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 59  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 101


>SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 29  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 71


>SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 379

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 48  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 90


>SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_59172| Best HMM Match : SecG (HMM E-Value=9.5)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 67  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 109


>SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 33  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 75


>SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 222

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 121 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 163


>SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 36  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 78


>SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 24  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 66


>SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 45  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 87


>SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 42  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 84


>SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 59  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 101


>SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 96  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 138


>SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 28  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 70


>SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 24  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 66


>SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 51  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 93


>SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 47  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 89


>SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5)
          Length = 174

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 72  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 114


>SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 30  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 72


>SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 34  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 76


>SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 86  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 128


>SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 65  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 107


>SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 499

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 277 QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 319


>SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07)
          Length = 216

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 55  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 97


>SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 72  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 114


>SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 31  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 73


>SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 170

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 68  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 110


>SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 35  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 77


>SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08)
          Length = 215

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 54  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 96


>SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 59  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 101


>SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


>SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 43  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 85


>SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 25  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 67


>SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 51  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 93


>SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 39  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 81


>SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 65  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 107


>SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 66  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 108


>SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 26  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 68


>SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 173

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 72  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 114


>SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 55  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 97


>SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 48.0 bits (109), Expect = 1e-05
 Identities = 26/44 (59%), Positives = 26/44 (59%)
 Frame = +3

Query: 636 QFAPSESYYIPWAVXLQRRDWENPGRYPTLIALQAHXPFGQLGN 767
           QFA  ESYY   AV LQRRDWENPG    L  L AH PF    N
Sbjct: 23  QFALYESYYNSLAVVLQRRDWENPG-VTQLNRLAAHPPFASWRN 65


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,773,735
Number of Sequences: 59808
Number of extensions: 421081
Number of successful extensions: 3867
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 3733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3857
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2526446612
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -