SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30135.Seq
         (856 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             184   1e-46
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              184   1e-46
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         184   1e-46
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      184   1e-46
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              184   1e-46
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             128   8e-30
SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)                    125   5e-29
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          98   7e-21
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              95   6e-20
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             83   3e-16
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  64   1e-10
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   3e-09
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 55   6e-08
SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)                 50   2e-06
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               46   4e-05
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.097
SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22)               33   0.39 
SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4)            32   0.52 
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.90 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.90 
SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2)                    31   0.90 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.90 
SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)                     31   1.6  
SB_58292| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12)                 30   2.8  
SB_32794| Best HMM Match : Gam (HMM E-Value=5.8)                       30   2.8  
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  30   2.8  
SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)                  30   2.8  
SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.8  
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      30   2.8  
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  30   2.8  
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        29   3.6  
SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    29   3.6  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       29   3.6  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.6  
SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45)               29   4.8  
SB_41539| Best HMM Match : PUD (HMM E-Value=0.42)                      29   4.8  
SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38)                29   4.8  
SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45)               29   4.8  
SB_53526| Best HMM Match : Cohesin (HMM E-Value=8.4)                   29   4.8  
SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.8  
SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041)                 29   4.8  
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    29   4.8  
SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.4  
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.4  
SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45)              29   6.4  
SB_51831| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 28   8.4  
SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_11339| Best HMM Match : TGF_beta (HMM E-Value=5.60519e-45)          28   8.4  
SB_6983| Best HMM Match : rve (HMM E-Value=0.011)                      28   8.4  
SB_7076| Best HMM Match : IncA (HMM E-Value=0.74)                      28   8.4  
SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41)             28   8.4  

>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  128 bits (308), Expect = 8e-30
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  123 bits (296), Expect = 2e-28
 Identities = 56/62 (90%), Positives = 60/62 (96%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNSPAMYVAIQAVLSL 142



 Score =  125 bits (301), Expect = 5e-29
 Identities = 62/78 (79%), Positives = 65/78 (83%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKL YV
Sbjct: 203 TAEREIVR-DIKEKLAYV 219



 Score =  120 bits (289), Expect = 2e-27
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 117

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 118 KMTQIMFETFNSPAMYVAIQAVLSL 142



 Score =  128 bits (310), Expect = 4e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 143 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 202

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 203 TAEREIVR-DIKEKLCYV 219



 Score =  121 bits (292), Expect = 7e-28
 Identities = 55/60 (91%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  128 bits (310), Expect = 4e-30
 Identities = 63/78 (80%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD +   LTDYLMKILTERGYSF T
Sbjct: 144 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 204 TAEREIVR-DIKEKLCYV 220



 Score =  127 bits (307), Expect = 1e-29
 Identities = 57/62 (91%), Positives = 61/62 (98%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  184 bits (447), Expect = 1e-46
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 434
           AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE
Sbjct: 59  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 118

Query: 435 KMTQIMFETFNTPAMYVAIQAVLSL 509
           KMTQIMFETFN+PAMYVAIQAVLSL
Sbjct: 119 KMTQIMFETFNSPAMYVAIQAVLSL 143



 Score =  123 bits (296), Expect = 2e-28
 Identities = 54/62 (87%), Positives = 60/62 (96%)
 Frame = +1

Query: 82  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHR 261
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE +
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 262 AK 267
           +K
Sbjct: 61  SK 62



 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 2/30 (6%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYE--GYA 592
           YASGRTTGIV+DSGDGVSHTVPIYE  GY+
Sbjct: 144 YASGRTTGIVMDSGDGVSHTVPIYEERGYS 173


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  128 bits (308), Expect = 8e-30
 Identities = 62/78 (79%), Positives = 66/78 (84%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI+RLD +   LTDYLMKILTERGYSF T
Sbjct: 106 YASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTT 165

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 166 TAEREIVR-DIKEKLCYV 182



 Score =  121 bits (292), Expect = 7e-28
 Identities = 54/60 (90%), Positives = 59/60 (98%)
 Frame = +1

Query: 88  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEHRAK 267
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE ++K
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61



 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/33 (90%), Positives = 30/33 (90%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 353
           AQSKRGILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 58  AQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/28 (78%), Positives = 25/28 (89%)
 Frame = +3

Query: 426 NREKMTQIMFETFNTPAMYVAIQAVLSL 509
           N + M +IMFETFN+PAMYVAIQAVLSL
Sbjct: 78  NWDDMEKIMFETFNSPAMYVAIQAVLSL 105


>SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)
          Length = 152

 Score =  125 bits (301), Expect = 5e-29
 Identities = 60/78 (76%), Positives = 64/78 (82%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YASGRTTG+V DSGDGVSH VPIYEGYALPHAILRLD +   LTDYLMK++TERGYSF T
Sbjct: 22  YASGRTTGVVFDSGDGVSHNVPIYEGYALPHAILRLDLAGRDLTDYLMKLMTERGYSFTT 81

Query: 689 NAXREIRS*TFKEKLCYV 742
            A REI     KEKLCYV
Sbjct: 82  TAEREIVR-DIKEKLCYV 98



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 18/21 (85%), Positives = 20/21 (95%)
 Frame = +3

Query: 447 IMFETFNTPAMYVAIQAVLSL 509
           IMFE FN+PA+YVAIQAVLSL
Sbjct: 1   IMFEAFNSPAVYVAIQAVLSL 21


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 98.3 bits (234), Expect = 7e-21
 Identities = 46/77 (59%), Positives = 56/77 (72%)
 Frame = +2

Query: 509  YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
            YASGRTTG V D GDGVSHTVP+Y+GY LPHA  R+D +   LT YL +++TERGYSF +
Sbjct: 2188 YASGRTTGTVFDCGDGVSHTVPVYDGYWLPHATQRIDLAGRDLTHYLQRLVTERGYSFQS 2247

Query: 689  NAXREIRS*TFKEKLCY 739
             A ++I     KE LCY
Sbjct: 2248 TAEQQIIR-DLKETLCY 2263



 Score = 88.2 bits (209), Expect = 7e-18
 Identities = 39/59 (66%), Positives = 49/59 (83%)
 Frame = +3

Query: 333  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
            K+W H F ++LRV  E+ PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QAV++L
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMAL 2187



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 106  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 207
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score = 95.1 bits (226), Expect = 6e-20
 Identities = 42/86 (48%), Positives = 60/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANR 431
           A   R +L + YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE PLNP  NR
Sbjct: 61  ASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNR 120

Query: 432 EKMTQIMFETFNTPAMYVAIQAVLSL 509
           EKM ++MFE +    +Y+AIQAVL+L
Sbjct: 121 EKMIEVMFENYQFEGVYIAIQAVLTL 146



 Score = 88.6 bits (210), Expect = 6e-18
 Identities = 43/80 (53%), Positives = 55/80 (68%), Gaps = 1/80 (1%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA G  TG+V+DSGDGV+H  P+YEG+ALPH   RLD +   +T YL+K++  RGY+F  
Sbjct: 147 YAQGLLTGVVIDSGDGVTHICPVYEGFALPHLTRRLDIAGRDITKYLIKLMLLRGYAFNH 206

Query: 689 NAXRE-IRS*TFKEKLCYVG 745
            A  E +R    KEKLCYVG
Sbjct: 207 TADFETVR--MMKEKLCYVG 224



 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (3%)
 Frame = +1

Query: 100 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDE 255
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGDE
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDE 60


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/74 (51%), Positives = 56/74 (75%)
 Frame = +2

Query: 509 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFIT 688
           YA+GRTTG+VLD+GDGVSH+VPIYEG+A+PH+I+R D +   ++ YL  +L + G+ F +
Sbjct: 169 YATGRTTGVVLDAGDGVSHSVPIYEGFAMPHSIMRTDIAGRDVSRYLRLLLRKEGHCFHS 228

Query: 689 NAXREIRS*TFKEK 730
           ++  EI   T KE+
Sbjct: 229 SSELEIVR-TIKEE 241



 Score = 71.3 bits (167), Expect = 9e-13
 Identities = 29/43 (67%), Positives = 38/43 (88%)
 Frame = +3

Query: 381 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 509
           +HPVLLTEAPLNP+ NREK  ++ FETFN PA+++++QAVLSL
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSL 168


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 26/72 (36%), Positives = 46/72 (63%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 470
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +  REK+T++MFE +N 
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLTELMFEKYNV 62

Query: 471 PAMYVAIQAVLS 506
           PA ++   +VL+
Sbjct: 63  PAFFLCKNSVLT 74



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +2

Query: 506 AYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFI 685
           A+A+GR+ G+V+DSG   +  VP+++GY L  AI+R   +   +T    ++  E     I
Sbjct: 75  AFANGRSNGLVIDSGATQTSAVPVHDGYVLQQAIVRSPLAGDFITAQCRQMFEETNVEVI 134


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +1

Query: 91   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 207
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +2

Query: 509  YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKIL-TERGYSFI 685
            YASG T G+ L SG   +    IYEG+ L H +  L+     LT+ L + L  +RG++F 
Sbjct: 773  YASGMTLGVCLSSGFSCTQAAVIYEGHTLNHTLQTLEIGGHHLTENLKQYLRDQRGHNFT 832

Query: 686  TNAXREIRS*TFKEKLCYV 742
            +++  +I +   KEK+CY+
Sbjct: 833  SSSGWQIVN-DIKEKICYL 850



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 76  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 222
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 741


>SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)
          Length = 543

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 25/79 (31%), Positives = 42/79 (53%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPIYEGYALPHAILRLDFSRSRLTDYLMKILTERGYSFITNAXREI 706
           TG V+DSGDGV+H +P+ EGY +   I  +  +   +T ++ ++L ER          E 
Sbjct: 62  TGCVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITFFVQQLLREREMGIPPEQSMET 121

Query: 707 RS*TFKEKLCYVGS*LSKQ 763
              T KE+  Y+   ++K+
Sbjct: 122 AK-TIKERWGYICPDIAKE 139


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +3

Query: 285 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 398
           K+PI H IV +WD ME+ W    +  LR  PE+H  LL
Sbjct: 299 KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336



 Score = 32.3 bits (70), Expect = 0.52
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = +2

Query: 527 TGIVLDSGDGVSHTVPI 577
           TG V+DSGDGV+H +P+
Sbjct: 356 TGCVIDSGDGVTHVIPV 372


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -2

Query: 204 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 88
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 34.7 bits (76), Expect = 0.097
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 3/60 (5%)
 Frame = +3

Query: 525 PPVSCWTPATVSPTPCPSTRDTHSPT-PSCVWTLAGRDSQTTS*RFSPS--AATRSLPTP 695
           P ++  TP T +PTP   T  TH+PT PS     +   +QTT    +PS  A T++ PTP
Sbjct: 13  PTLTKATPQT-TPTPTKPTPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTP 71



 Score = 32.3 bits (70), Expect = 0.52
 Identities = 27/103 (26%), Positives = 38/103 (36%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           P   T  P  P       T    +T  TP          +   P  P  +  TP T +PT
Sbjct: 29  PTPTTHTPTKPSPTTPTSTAPT-QTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPT 87

Query: 567 PCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
               T+ T + TP+         + TT    +P+A T + PTP
Sbjct: 88  TSTLTKPTPATTPTPTKPTPTAHTPTTP---TPTAHTPTKPTP 127


>SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22)
          Length = 3445

 Score = 32.7 bits (71), Expect = 0.39
 Identities = 32/120 (26%), Positives = 48/120 (40%), Gaps = 8/120 (6%)
 Frame = +3

Query: 360  ELRVAPEEHPVL-LTEAP---LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
            E   APE   V   T AP   + P+     +T +  ET   PA   A++   +L   +VP
Sbjct: 1323 ETSAAPETTMVPETTSAPSTTMAPETTAAPVTTMAPETTAVPATIAALETTATLETTMVP 1382

Query: 528  PVSCWTPATVSP--TPCPSTRDTHSPT--PSCVWTLAGRDSQTTS*RFSPSAATRSLPTP 695
              +  +  TV+P  T  P+T      T  P   W      +  T+     +AAT +   P
Sbjct: 1383 ETTASSETTVAPETTDAPATTLAPETTAAPETTWAPETTSAPETTVAPEITAATETTAAP 1442


>SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4)
          Length = 1439

 Score = 32.3 bits (70), Expect = 0.52
 Identities = 32/121 (26%), Positives = 43/121 (35%), Gaps = 4/121 (3%)
 Frame = +3

Query: 345 HTFYNELRVAP--EEHPVLLTEAPLNPKAN--REKMTQIMFETFNTPAMYVAIQAVLSLT 512
           HT  N    AP    HP  L      P+A      M   + ET   P M      V    
Sbjct: 276 HTISNPAMAAPWVTPHPATLPVTLFTPQAAPVTPPMGAQLPET-EQPQMVAPSSTVTPPV 334

Query: 513 RPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPT 692
               PP S   P    PTP  +     +P PS   + +G  +   +   S  A++  +PT
Sbjct: 335 TEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPT 394

Query: 693 P 695
           P
Sbjct: 395 P 395


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +3

Query: 282 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP--EEHPVLLTEAPLNPKANRE 434
           L+ P +  +VT+++  E++  H F +     P    HPV++TE   NP   R+
Sbjct: 131 LRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGGVNHPVIMTEPVCNPNYCRQ 183


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 179 GNTARGASSPAKPALHIPEPLSTT 108
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2)
          Length = 563

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = +1

Query: 451 CSKHSTRPPCTSPSKPCSRLRVRSYHRYRAG 543
           C  H+ R P T+PS PC  +   S   Y AG
Sbjct: 360 CYSHARREPSTAPSLPCDLVAATSAKMYLAG 390


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.90
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 179 GNTARGASSPAKPALHIPEPLSTT 108
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 566

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = -1

Query: 694 GVGNERVAALGENLHEVVCESRP-AKVQTQDGVGECVSLVDGHG 566
           G  N+R   LG  +H +   S+P A    +D + EC     GHG
Sbjct: 60  GENNDRQEELGREIHALSSASKPLAGFTARDAIQECREACGGHG 103


>SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)
          Length = 231

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 2/82 (2%)
 Frame = +3

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPS--AATRSLP 689
           P   P + +T  T S TP PS   T S TP+  +T     + TTS   +PS    T   P
Sbjct: 30  PSYTPTTSYT-CTTSYTPTPSYTPTPSYTPTTSYTPTTSYTPTTSYTPTPSYTPTTSYTP 88

Query: 690 TPXGKFVREHSRRSCATSALDF 755
           TP       ++  +  TS   +
Sbjct: 89  TPSYTSTTSYTPTTSYTSTTSY 110


>SB_58292| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVV---PPVSCWTPATV 557
           P L+T  PL        +T       NTP +      ++++T P+V   PP+   TP  V
Sbjct: 34  PSLVTTTPLLVTTTPSLVTTTPLLVTNTPPLDTTTLPLVTITPPLVITAPPLVTTTPPLV 93

Query: 558 SPTP 569
           + TP
Sbjct: 94  TTTP 97


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -3

Query: 179 GNTARGASSPAKPALHIPEPLSTT 108
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1259

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +2

Query: 407 SPQPQGQQREDDPDHVRNIQHARHVRRHPSR 499
           SP P+   R D+P  V     A HV  HPSR
Sbjct: 265 SPTPKRCVRFDEPPTVEKYSKASHVTEHPSR 295


>SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12)
          Length = 439

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 22/73 (30%), Positives = 28/73 (38%)
 Frame = +3

Query: 387 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPT 566
           PVL   A   P A   + TQ      + P    ++  V +   P  PPV    P TV P 
Sbjct: 22  PVLTEAATTQPPAPPPEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTV-PP 80

Query: 567 PCPSTRDTHSPTP 605
           P  +   T  P P
Sbjct: 81  PVVTDAPTTVPPP 93


>SB_32794| Best HMM Match : Gam (HMM E-Value=5.8)
          Length = 511

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 13/52 (25%), Positives = 22/52 (42%)
 Frame = -1

Query: 676 VAALGENLHEVVCESRPAKVQTQDGVGECVSLVDGHGVGDTVAGVQHDTGGT 521
           +  L  +LHE +    PA  Q+ D + +C+  +  HG+         D   T
Sbjct: 43  IQMLSASLHEQLFPDTPANTQSTDVIQKCIEHLSAHGLWGKAKSAARDVDMT 94


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +3

Query: 174 VPLDRGKAPPSGRDGRYGTEGLLCRR*AQSKRGILTLKYPIEHGIVTNW--DDMEKIWHH 347
           V L +     +GR+   G+   +CR+    K  ++TL + I  G+  +   D  EK+W+H
Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRK----KAPLITLSHVIRMGLALSLVSDVKEKVWYH 496

Query: 348 TFYN 359
           T  N
Sbjct: 497 TCPN 500


>SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)
          Length = 286

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 19/65 (29%), Positives = 25/65 (38%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLP 689
           T P     +  TP T   TP   T    +PT +     AG  +        P+AA  + P
Sbjct: 123 TAPTTAATTPTTPTTAPTTPTTPTTAATTPTTAATTPAAGAAAAAAP---PPAAAAAAPP 179

Query: 690 TPXGK 704
            P GK
Sbjct: 180 PPVGK 184


>SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 5659

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = +3

Query: 348  TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
            T   E  VAPE    +  E  ++P+      T +  ET  TP   VA +  ++    V  
Sbjct: 4182 TMAPETTVAPET--TMAAETTVSPETTEASGTTVASETTTTPETTVAPETTMAPETTVAL 4239

Query: 528  PVSCWTPATVSPTPCPSTRDTHSP 599
              +     TV+P    +   T +P
Sbjct: 4240 ETTMAPETTVAPETTIAPESTEAP 4263


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 224 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +3

Query: 291 PIEHGIVTNWDDMEKIWHHTFYNE 362
           P + G + NWD  ++IW +TF  E
Sbjct: 292 PFQKGFLVNWDVEKQIWDYTFGKE 315


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 419 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454


>SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/65 (26%), Positives = 24/65 (36%)
 Frame = +3

Query: 405  APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTR 584
            A   P A       +  + +NTP     I +      P +PP +  TP+   P P PS  
Sbjct: 888  ASYQPSAPSSMPAPVPLQPYNTPMP--PISSTPYQAPPTLPPTTLTTPSWSQPVPVPSMY 945

Query: 585  DTHSP 599
                P
Sbjct: 946  QPQPP 950


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 282 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317


>SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2644

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 16/43 (37%), Positives = 17/43 (39%)
 Frame = +3

Query: 510  TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDS 638
            T P   P    T  TV PT  PS  D    T  C W  A  D+
Sbjct: 1702 TNPWTTPAPSPTATTVGPTLAPSQWDCSFETNLCSWMQAVNDN 1744


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 260 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 136 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171


>SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45)
          Length = 825

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 29/113 (25%), Positives = 42/113 (37%), Gaps = 1/113 (0%)
 Frame = +3

Query: 369 VAPEEHPVLLTEAPL-NPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWT 545
           + PE HP  L   P    +   +  T     T  +     A Q +L  + P +P  +  T
Sbjct: 118 IHPEVHPGPLPPPPAATARPGNQASTANPLSTPVSTTSTKATQGLLPSSTPEMPETAKPT 177

Query: 546 PATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATRSLPTPXGK 704
                 T  P+T  T   +PS   T   R +   +   +PS  T S  T  GK
Sbjct: 178 TVVTQVTTMPNTSVTPLTSPSTSVTQRTRPTTPVTQEATPS-QTSSASTSHGK 229


>SB_41539| Best HMM Match : PUD (HMM E-Value=0.42)
          Length = 1582

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +1

Query: 517  RSYHRYRAGLRRRCLPHRAHLRGIRTPPRHPASGL*PVATHRLPHE 654
            R   R R G R+   P +    G  TPP+ PA+        RL HE
Sbjct: 942  RRLRRSRKGTRKGDTPRKEGEAGAATPPQSPAAAPQSPPVQRLVHE 987


>SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38)
          Length = 839

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 4/84 (4%)
 Frame = +3

Query: 360 ELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVP 527
           E  VAPE        L  E    P+      +    +T   P   VAI++ L+L   V P
Sbjct: 19  ETTVAPETTSAADTTLAPETTFAPETTVPPESTAAPDTTVAPETTVAIESTLALESTVAP 78

Query: 528 PVSCWTPATVSPTPCPSTRDTHSP 599
             +  T  TV+P    +   T +P
Sbjct: 79  ETTVATETTVAPETTAAPESTLAP 102



 Score = 28.7 bits (61), Expect = 6.4
 Identities = 28/112 (25%), Positives = 43/112 (38%), Gaps = 6/112 (5%)
 Frame = +3

Query: 348 TFYNELRVAPE----EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTR 515
           T  +E  VAP+        L  E  + P+      + +  ET   P   VA +   +   
Sbjct: 487 TVASETTVAPKTTAASEATLAPETTVAPETTAAPESTLALETTAAPVTTVAPETTAAPDT 546

Query: 516 PVVPPVSCWTPATVSP--TPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSP 665
           P+VP  +    +TV+P  T  P T      TP+   T A   +  T    +P
Sbjct: 547 PIVPETTVALESTVAPEITVVPET------TPALETTSASESTDATESTVAP 592


>SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45)
          Length = 649

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 3/82 (3%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATV---SPTPCPSTRDTHSPTPSCVWTLAGRDSQTTS*RFSPSAATR 680
           T P+  P++  TP T    +PT   +T  T +   +  +    +   TTS   S + AT+
Sbjct: 393 TAPISDPMTTTTPTTTKATTPTTTKATASTQTAAEANTFLSTQKTDATTSQSTSTTEATK 452

Query: 681 SLPTPXGKFVREHSRRSCATSA 746
           S  T     +   + ++  TS+
Sbjct: 453 SQTTKATTTLSTSTTKATTTSS 474


>SB_53526| Best HMM Match : Cohesin (HMM E-Value=8.4)
          Length = 248

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 3/65 (4%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTH---SPTPSCVWTLAGRDSQTTS*RFSPSAATR 680
           T P   PV+       SPTP P T   +   SP P+ V      D+  T    +      
Sbjct: 115 TSPTPTPVTAKVNVDASPTPTPVTAKVNADASPNPTPVTAKVNADTSPTPTPVTAKVNVD 174

Query: 681 SLPTP 695
           + PTP
Sbjct: 175 ASPTP 179


>SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3306

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = -1

Query: 661  ENLHEVVCESRPAKVQTQDGVGECVSLVDGHGVGDTVAG 545
            E LH  + E RP      D   + V++ DG  V D VAG
Sbjct: 1480 EALHASLLEKRPLLATAHDSGNKLVAVCDGPRVEDDVAG 1518


>SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 274

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +3

Query: 504 SLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCV 614
           SLT P + PV+  TP+T   T  PST D+   T   V
Sbjct: 192 SLTSPAIQPVAPATPSTT--TTAPSTADSKETTSPLV 226


>SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041)
          Length = 1059

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 10/72 (13%)
 Frame = +1

Query: 454 SKHSTRPPCTSPSKPCSRL--------RVRSY--HRYRAGLRRRCLPHRAHLRGIRTPPR 603
           S++ TRP  TSP+   +R+        +++S+  +RY +     C PHRA L   + PP 
Sbjct: 448 SQNKTRPNYTSPTTNAARIVNEGSKHTKIKSWLLNRYSSSTFNTC-PHRA-LPAWKGPPL 505

Query: 604 HPASGL*PVATH 639
           H  +   P A H
Sbjct: 506 HVDATAKPTACH 517


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = -2

Query: 237 VLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 127
           ++LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 184 IVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219


>SB_48166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%)
 Frame = +3

Query: 432 EKMTQIMFETFNTPAMYVAIQAV----LSLTRPVVPP-VSCWTPATVSPTPC 572
           +K T +    F TP++           ++LT P VPP V+   P T +P PC
Sbjct: 188 DKQTDVCHLIFPTPSLGTQAPPPSTGGVTLTTPTVPPRVASTEPTTFTPKPC 239


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 13/36 (36%), Positives = 16/36 (44%)
 Frame = +3

Query: 501  LSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPS 608
            +  TRP VP       +T  PTP P T     P P+
Sbjct: 929  IQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPA 964


>SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45)
          Length = 3094

 Score = 28.7 bits (61), Expect = 6.4
 Identities = 29/104 (27%), Positives = 42/104 (40%), Gaps = 4/104 (3%)
 Frame = +3

Query: 348 TFYNELRVAPEEH-PVLLTEAP---LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTR 515
           T   E  VAPE   P   T AP   + P+        +  ET   P   VA +  ++   
Sbjct: 532 TVATESTVAPEVTLPPGTTVAPETTVAPETTAAPEITVAPETTEAPDTTVAPETTVAPES 591

Query: 516 PVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDSQTT 647
            V P  +     TV+P    S   T +P  S VW ++  + +TT
Sbjct: 592 TVAPETTVAPETTVAPEITASRETTVAPE-STVWPVSTVEPKTT 634


>SB_51831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1065

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%)
 Frame = +3

Query: 366  RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLTRPVVPPVSCWT 545
            ++A + +P +  E   N K + +K+ Q M +T         +  +  + R     +  W 
Sbjct: 866  KIASKHNPEMTEEMRANLKEHLDKINQRMNDTMTL------LYNMPKIMRKFAFELPNWA 919

Query: 546  PATVSPTPCPSTRDTHSP-TPSCV 614
            P    PT  P+ + T +P TPS V
Sbjct: 920  PKIPLPTEPPTEKMTEAPTTPSAV 943


>SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1054

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
 Frame = -1

Query: 586 SLVDGHGVGDTVAGVQHDTGG--TTGRVSESTAWMATY 479
           +L  GHGV     G    TGG  + GRV+   +W+  Y
Sbjct: 581 TLFSGHGVISASGGAGSGTGGGGSGGRVAAHVSWLREY 618


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 2/91 (2%)
 Frame = -1

Query: 385 CSSGATRSSL*KV*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCAH--LLHKSPSVPYRPS 212
           CS       +  + C    +  ++V   CS   + V +  ++C+   + H+       PS
Sbjct: 88  CSPSRAHVDVFPITCSCRCVPHRMVMSMCSPSRVYVDVSPIVCSCRCVPHRVLMSMCSPS 147

Query: 211 RPDGGAFPRSRGTRREEHHLLRNRPCTYRSH 119
           R D   FP +   R   HH+L +   + R+H
Sbjct: 148 RADVDVFPITCSRRCVFHHVLMSMCSSSRAH 178


>SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2834

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 23/79 (29%), Positives = 35/79 (44%)
 Frame = +3

Query: 459  TFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCVWTLAGRDS 638
            T  TP++  + QA  S+        S  +   V+P+   ST+   S TPS      G  S
Sbjct: 1840 THLTPSVASSTQAASSVILSAEVTTSVTSSTQVTPSVASSTQAATSVTPS----TQGMPS 1895

Query: 639  QTTS*RFSPSAATRSLPTP 695
               S + +PS A+ +  TP
Sbjct: 1896 VAPSTQMTPSVASSTQVTP 1914


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -3

Query: 179 GNTARGASSPAKPALHIPEPLSTT 108
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -3

Query: 179 GNTARGASSPAKPALHIPEPLSTT 108
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_11339| Best HMM Match : TGF_beta (HMM E-Value=5.60519e-45)
          Length = 481

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 11/44 (25%), Positives = 21/44 (47%)
 Frame = +3

Query: 456 ETFNTPAMYVAIQAVLSLTRPVVPPVSCWTPATVSPTPCPSTRD 587
           + +  P  +  +Q +++   P + P +C TP  +SP     T D
Sbjct: 288 DNYLRPTNHATVQTIVNSLDPSIAPKACCTPNELSPISILYTED 331


>SB_6983| Best HMM Match : rve (HMM E-Value=0.011)
          Length = 251

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 510 TRPVVPPVSCWTPATVSPTPCPSTRDTHSPTPSCV 614
           T  VVPP+    P  V P+P     +  SPTPSC+
Sbjct: 207 TPAVVPPI----PTLVVPSPLTQP-EVESPTPSCI 236


>SB_7076| Best HMM Match : IncA (HMM E-Value=0.74)
          Length = 282

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 6/70 (8%)
 Frame = +2

Query: 371 RPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAY------ASGRTTG 532
           R R  P PA+        ++R   P     I H R VR+   RA A       ASG   G
Sbjct: 82  RGRRCPPPANAYRSGKHRRRRAKFPTPDNEITHYRQVRKKYKRAFAVTHAVSVASGVAAG 141

Query: 533 IVLDSGDGVS 562
           ++  +G GVS
Sbjct: 142 VLSSAGLGVS 151


>SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41)
          Length = 653

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 2/53 (3%)
 Frame = -1

Query: 721 ECSR--TNFPXGVGNERVAALGENLHEVVCESRPAKVQTQDGVGECVSLVDGH 569
           EC R  T  P G G   +    +     +C S   K   +DG  EC+   DG+
Sbjct: 343 ECKRGFTPKPNGKGCTDINECDDQAARSLCPSDKTKCMNRDGFFECMCKADGY 395


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,808,374
Number of Sequences: 59808
Number of extensions: 711010
Number of successful extensions: 2842
Number of sequences better than 10.0: 65
Number of HSP's better than 10.0 without gapping: 2344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2789
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2431332827
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -