SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30132.Seq
         (689 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_14512| Best HMM Match : IncA (HMM E-Value=0.12)                     31   0.67 
SB_16484| Best HMM Match : MSG (HMM E-Value=0.24)                      30   1.5  
SB_15482| Best HMM Match : LIM (HMM E-Value=0)                         29   2.7  
SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9)                   29   3.6  
SB_16968| Best HMM Match : Laminin_EGF (HMM E-Value=0)                 29   4.7  
SB_38221| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.2  
SB_22219| Best HMM Match : LIM (HMM E-Value=8.2e-22)                   28   6.2  
SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.2  
SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43)               28   6.2  
SB_58790| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_44285| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_15250| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  

>SB_14512| Best HMM Match : IncA (HMM E-Value=0.12)
          Length = 642

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 466 AFHSHCAKCYFCHTVHRPTSTSAMVKSSASL 558
           A+ S CA+C  C  +  P + +A   SS SL
Sbjct: 433 AYSSFCARCLICSAIEAPAAVAAFFLSSTSL 463


>SB_16484| Best HMM Match : MSG (HMM E-Value=0.24)
          Length = 661

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 4/87 (4%)
 Frame = +1

Query: 256 HVLDRFRGECPSV--HTNWAQWTCGKFGNGQEG--DNPGASSKSEASEGNTKRSVCSRCL 423
           H   R    C  +  H+N +  +C K GN  +    +   SS S    GN+ + + S   
Sbjct: 150 HCYKRRGNSCQDIPSHSNTSSDSCKKRGNSCQDIPSHSNTSSDSCQKRGNSCQDIPSHSK 209

Query: 424 QMINENNKIEIDKQAFHSHCAKCYFCH 504
           Q  +    +  DK+A  S C     C+
Sbjct: 210 QSSDGTIHVTKDKEAITSSCDNLEHCN 236


>SB_15482| Best HMM Match : LIM (HMM E-Value=0)
          Length = 349

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 9/39 (23%), Positives = 22/39 (56%)
 Frame = +1

Query: 391 NTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFCHT 507
           N + ++C+ C + I +   +++  +A+H  C +C  C +
Sbjct: 40  NGRVNICTGCNEPIEDRFLMKVVDEAWHESCLQCCICRS 78


>SB_32869| Best HMM Match : Toxin_7 (HMM E-Value=3.9)
          Length = 910

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 275 EANVHLSTQTGPSGLVESLEMVRRGIILEQAANQRPLKGILNAASAL 415
           EA   LS + GP  L   L+  R     ++ A QRPL  I +AAS +
Sbjct: 402 EAQEVLSLRQGPVRLARMLKTPRARKARDEFAGQRPLFAICDAASLM 448


>SB_16968| Best HMM Match : Laminin_EGF (HMM E-Value=0)
          Length = 1101

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 16/63 (25%), Positives = 26/63 (41%)
 Frame = +1

Query: 319 CGKFGNGQEGDNPGASSKSEASEGNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYF 498
           C   G+ +  D P  + K+     NT    C RCL + N    +    +   + C +C  
Sbjct: 264 CKCHGHARWCDFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCE- 322

Query: 499 CHT 507
           CH+
Sbjct: 323 CHS 325


>SB_38221| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 575

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           C+ C + + E   +  + + +H  C  CYFCH
Sbjct: 463 CASCGEPLLEGGVL-YNGETWHKACFSCYFCH 493


>SB_22219| Best HMM Match : LIM (HMM E-Value=8.2e-22)
          Length = 163

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +1

Query: 409 CSRCLQMINENNKIEIDKQAFHSHCAKCYFCH 504
           C+ C + + E   +  + + +H  C  CYFCH
Sbjct: 51  CASCGEPLLEGGVL-YNGETWHKACFSCYFCH 81


>SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 560

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 2/96 (2%)
 Frame = -3

Query: 594 CPYVGARRDVGSKARRRLDHSRCGCWTMDRVAKIALGTVTMEGLLVN-FNFVILVDHLKA 418
           C     R   G+KA +R   +R GC   D    +  G +    + +N FN  I   H+K 
Sbjct: 237 CQSKNKRLKAGNKAVKRAKETRNGCRKCDVHLCVFAGNMDENNISINFFNREIQTRHVKI 296

Query: 417 SRADAAFSIPFRGL*FAACSRII-PLLTISKLSTSP 313
                   +  R + F  C  ++  ++T+ +  ++P
Sbjct: 297 IPISWYHRVSLR-VDFYGCKHVVSSIVTVQEALSAP 331


>SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43)
          Length = 511

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 388 GNTKRSVCSRCLQMINENNKIEIDKQAFHSHCAKCYFC 501
           G+ +++VC+ C   I E   +    Q +H+ C KC  C
Sbjct: 241 GDKQQAVCAGCGSRILERFYLMAVDQEWHADCLKCSDC 278


>SB_58790| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1005

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 20/84 (23%), Positives = 34/84 (40%)
 Frame = +1

Query: 178 VLRLQNNSVGGEDVLRARILQWMLQAHVLDRFRGECPSVHTNWAQWTCGKFGNGQEGDNP 357
           V+    +S  G D++         ++ VL  + GE P   +    WTC K   G   ++ 
Sbjct: 613 VMDSSRSSCRGADIVHLPNQIAACKSCVLTHYGGEYPVQGSVPCCWTCVKCPRGSIKNST 672

Query: 358 GASSKSEASEGNTKRSVCSRCLQM 429
           G        +G T  +  S CL++
Sbjct: 673 GTGGCVPCDKGYTSDAGNSECLKL 696


>SB_44285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -2

Query: 223 VEHLHRRRNCSADATRAANSMKALPCYFNGVFRIH 119
           V+H+ R+  C   +     S+KAL C+ + V RI+
Sbjct: 23  VQHIRRKYRCLGPSGSLQPSVKALCCHTDWVIRIY 57


>SB_15250| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -2

Query: 223 VEHLHRRRNCSADATRAANSMKALPCYFNGVFRIH 119
           V+H+ R+  C   +     S+KAL C+ + V RI+
Sbjct: 23  VQHIRRKYRCLGPSGSLQPSVKALCCHTDWVIRIY 57


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,587,613
Number of Sequences: 59808
Number of extensions: 479482
Number of successful extensions: 1654
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1652
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1793485733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -