SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30131.Seq
         (482 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0)               143   6e-35
SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)                   29   2.0  
SB_50413| Best HMM Match : GRP (HMM E-Value=0.15)                      29   2.0  
SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4)                  29   2.7  
SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.)                 28   3.5  
SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044)                 28   4.6  
SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017)                  28   4.6  

>SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0)
          Length = 328

 Score =  143 bits (347), Expect = 6e-35
 Identities = 67/84 (79%), Positives = 75/84 (89%)
 Frame = +3

Query: 3   KLVLAARAVVAIENPADVFVISSRXFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAF 182
           KL+LAAR +V IENPADV VIS+R +GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAF
Sbjct: 57  KLLLAARIIVTIENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAF 116

Query: 183 REPRLLIVLDPAQXHQPITEASYV 254
           REPRLLIV DP   HQP+TEASYV
Sbjct: 117 REPRLLIVCDPRIDHQPVTEASYV 140



 Score = 95.9 bits (228), Expect = 2e-20
 Identities = 42/74 (56%), Positives = 50/74 (67%)
 Frame = +2

Query: 257 IPVIAXCNTDSPLXFVDIAIPCNTKSSHSIGLMWWXXXXXXXXXXXXXPRDQXWDVVVDL 436
           IPVIA CNTDSPL  VD+AIPCN K  HSIGLM+W              R   W+++ DL
Sbjct: 142 IPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISRALPWEIMPDL 201

Query: 437 FFYRDPEESEKDEQ 478
           +FYRDPEE+EK+EQ
Sbjct: 202 YFYRDPEEAEKEEQ 215


>SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1772

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = -3

Query: 435  KSTTTSQXWSRGSTPRSLSXSRANNHHIKPIEWEDLVLHGIAMST 301
            K+TT    WS+G TP      ++   H   I    L+ HG   ST
Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPST 1438


>SB_50413| Best HMM Match : GRP (HMM E-Value=0.15)
          Length = 487

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = -2

Query: 448 TVEEQINHNIPALVTGKHTTKPXXFTCQQPPHQTNRVGR-LGVAWDSNVHK 299
           +V  Q+  + P  +T  HT+     T   P HQ + +GR  G   DSNV +
Sbjct: 241 SVTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291


>SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4)
          Length = 158

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = +1

Query: 34  PSRTPLMCSSSHHGPSVSVLY*SLPXTPVLRLLRDVSHQVLLLTRSKLHSVNL 192
           PSRTPL   ++ +G  +S+ Y       VLR+ R   H ++ ++R  L ++N+
Sbjct: 49  PSRTPLSQHNNGYGLRISI-YAVRYTAMVLRINRFALHIIVTVSRITLSAINV 100


>SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 965

 Score = 28.3 bits (60), Expect = 3.5
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -1

Query: 218 CRVQYNQETRFTECSLDLVSKSTWCETSRNRRST 117
           CR Q NQ T FT   +  ++    C+T RN RS+
Sbjct: 897 CRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSS 930


>SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044)
          Length = 899

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = -1

Query: 65  DDEHISGVLDGYDSTSSQNK 6
           ++EHI+ VLDGYD   S +K
Sbjct: 60  NEEHIAFVLDGYDELPSSSK 79


>SB_6137| Best HMM Match : NACHT (HMM E-Value=0.00017)
          Length = 1243

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = -1

Query: 65  DDEHISGVLDGYDSTSSQNK 6
           ++EHI+ VLDGYD   S +K
Sbjct: 346 NEEHIAFVLDGYDELPSSSK 365


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,929,126
Number of Sequences: 59808
Number of extensions: 299264
Number of successful extensions: 546
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 515
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 546
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1013948003
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -