SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30125.Seq
         (682 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.)             109   2e-24
SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.)               69   3e-12
SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13)                64   8e-11
SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.5  
SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029)                  29   3.5  
SB_12710| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  

>SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score =  109 bits (263), Expect = 2e-24
 Identities = 53/89 (59%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +3

Query: 258 TAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSV-- 431
           T  EL++YDG +    VLMAVNG +FDVTRG  FYGPGGPY+ F G DA+RGLATFS+  
Sbjct: 62  TLDELKEYDGLKSP-YVLMAVNGKVFDVTRGKDFYGPGGPYSNFAGHDASRGLATFSLGP 120

Query: 432 TAPEKDYDDLSDLNSMEMESVREWEDNLE 518
            A + +YDDLSDLN M+ +S+REWE   +
Sbjct: 121 EAIKDEYDDLSDLNGMQQDSLREWEQQFD 149



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +2

Query: 509 QFRENYDLVGRLLRPGEEPRNY-SDEEPEEAD 601
           QF E YDLVGRLL+PGE+ + Y ++EE EE D
Sbjct: 147 QFDEKYDLVGRLLKPGEKHQQYETEEETEEED 178


>SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 232

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           +  T  EL+ YDG  +   + +AVNG +FDVT    ++GP GP  +  G+DA+R L TFS
Sbjct: 72  REFTVRELKGYDGVNKE-LIYVAVNGKVFDVTSAWNYFGPAGPDCLLAGKDASRALVTFS 130

Query: 429 V-----TAPEKDYDDLSDLNSMEMESVREWE 506
           V     T      DDL+DLN ++ + + E+E
Sbjct: 131 VDNFYQTEQRDSMDDLNDLNPLQRDCLFEYE 161


>SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13)
          Length = 310

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           ++  +L ++DG+Q    + +A+ G ++DV +G RFYGPG  Y VF GRD+T    T  + 
Sbjct: 88  LSTEDLAKHDGSQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVT-GMF 146

Query: 435 APEKDYDDLSDLNSMEMESVREW 503
              K  DD S+L + ++  ++ W
Sbjct: 147 DRAKATDDCSNLKNEDLLGIKGW 169


>SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 393

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/61 (40%), Positives = 39/61 (63%)
 Frame = +3

Query: 255 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 434
           ++ V+L ++DG Q    + +A+ G ++DV +G RFYGPG  Y VF GRD+T    T  V+
Sbjct: 272 LSTVDLVKHDGLQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVTVLVS 331

Query: 435 A 437
           +
Sbjct: 332 S 332


>SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 249 KRMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 428
           K  T  EL  ++G      + +AV G +FDV+     YG G  Y    G++ +R +A +S
Sbjct: 46  KLFTKDELATFNGRNSNSPIYVAVKGVVFDVSTSKDLYGYGESYNSMAGKECSRAIAKWS 105

Query: 429 VTAPEKDYDDLSDLNSMEMESVRE 500
           + A E    +L  L   E++ + +
Sbjct: 106 LAA-ENMNGNLDGLTKDELQRLEK 128


>SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 13/61 (21%)
 Frame = +2

Query: 494 EGMGGQFRENYDLVGRLLRPGEEPRNYSDEEPE------------EADTSALPN-DDKEN 634
           E + G+F    D + R L PG +P   SD+E E            + DTS +PN  +KE 
Sbjct: 360 EDLDGRFAAGQDAMYRPLSPGNKPNEESDDEDELDKFMKGIEEEVKKDTSKIPNKTEKEK 419

Query: 635 Q 637
           Q
Sbjct: 420 Q 420


>SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 542

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -2

Query: 204 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 55
           C I+ + F+QY  CT +       T +C   +K   + G+HI  +L W +H
Sbjct: 477 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 524


>SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029)
          Length = 511

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -2

Query: 204 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 55
           C I+ + F+QY  CT +       T +C   +K   + G+HI  +L W +H
Sbjct: 407 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 454


>SB_12710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +2

Query: 467 SQLYGNGISEGMGGQFRENYDLVGRLLRPGEEPRNYSDEEPEEADTSALPNDDKENQI 640
           S+L  N  S+    QF   +DLVG +L         S+EE E+     +P + K N +
Sbjct: 8   SELTENTFSQAE--QFLPAFDLVGTILTTSRNISILSEEEVEKRKDDRIPENTKTNTV 63


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,870,444
Number of Sequences: 59808
Number of extensions: 466651
Number of successful extensions: 1227
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1225
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1757375282
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -