SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30124.Seq
         (669 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32)      111   5e-25
SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              29   4.5  
SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3)                  29   4.5  
SB_2086| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-07)                  28   7.9  

>SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32)
          Length = 245

 Score =  111 bits (267), Expect = 5e-25
 Identities = 61/105 (58%), Positives = 73/105 (69%), Gaps = 1/105 (0%)
 Frame = +1

Query: 355 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVSNVDSPS*V 534
           +VRK+LQL RLRQINNGVFVRLNKAT NMLRI +PYIA+GYPNLKSVREL+        V
Sbjct: 101 KVRKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGK-V 159

Query: 535 DNVYQSL-PTALLRRGSINTTLSVLRTFIHEIFTVGEKFKYASNF 666
           D    +L   +++ +      +  +   IHEIFTVGE FK ASNF
Sbjct: 160 DKQRVALTDNSIVEKVLGKHGIICVEDLIHEIFTVGEHFKEASNF 204



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +3

Query: 63  EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKE 242
           +D  K+P VPE++LK             +  L ++     K++EIFKRAE+YVKEYR KE
Sbjct: 3   QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62

Query: 243 RDEI 254
            DE+
Sbjct: 63  VDEL 66



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/34 (70%), Positives = 26/34 (76%)
 Frame = +2

Query: 281 GNYYVPGEAKLAFVIRIRGINQVSPKSVKFCNCL 382
           GN+YVP EA+LAFVIRIRGIN VSPK  K    L
Sbjct: 76  GNFYVPPEARLAFVIRIRGINGVSPKVRKILQLL 109


>SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1211

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/46 (34%), Positives = 22/46 (47%)
 Frame = +3

Query: 261 PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRSP*SSATV*TAPNK 398
           PDK A+  TTT P   +   ++     T + R P  S T+ T P K
Sbjct: 363 PDKTAVPKTTTAPETTDASKTTVETQQTTYSRDPEISVTISTQPKK 408


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKERDEID*PDK 269
           K R   IKK+    KR EQ+ KE + K+ +++D  +K
Sbjct: 132 KDRIKYIKKQESDLKRREQWQKEMKQKKDEQVDEREK 168


>SB_5458| Best HMM Match : E-MAP-115 (HMM E-Value=0.3)
          Length = 274

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +3

Query: 159 KRRSSAIKKKREIFKRAEQYVKEYRIKERDEID*PDK 269
           K R   IKK+    KR EQ+ KE + K+ +++D  +K
Sbjct: 136 KDRIKYIKKQESDLKRREQWQKEMKQKKDEQVDEREK 172


>SB_2086| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-07)
          Length = 827

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = +2

Query: 506 YQTWIRQAEWTTYTNHFQQHC 568
           Y  W RQAE T+  N + QHC
Sbjct: 807 YLKWSRQAERTSQCNAYIQHC 827


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,194,462
Number of Sequences: 59808
Number of extensions: 387343
Number of successful extensions: 860
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 799
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 858
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1729817375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -