SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30123.Seq
         (694 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)                    152   3e-37
SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)                    151   7e-37
SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)                    150   9e-37
SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)                    125   3e-29
SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)              111   7e-25
SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)              93   1e-19
SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)                     89   4e-18
SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)                     89   4e-18
SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)              88   7e-18
SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)                      88   7e-18
SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   2e-17
SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)                      86   2e-17
SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   3e-17
SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   5e-17
SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   7e-17
SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)                     59   3e-09
SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)                   54   8e-08
SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)                      53   3e-07
SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)                     51   8e-07
SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)                50   2e-06
SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)                   41   0.001
SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.095
SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)           31   0.67 
SB_33414| Best HMM Match : TSP_1 (HMM E-Value=0.00041)                 31   0.89 
SB_18800| Best HMM Match : Cytomega_UL20A (HMM E-Value=7.7)            30   1.5  
SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.7  
SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0)                 28   6.2  
SB_43063| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.2  

>SB_17879| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  152 bits (368), Expect = 3e-37
 Identities = 76/145 (52%), Positives = 95/145 (65%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR+VLIDL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELMDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSIVPSPKVSDTVVEPYNATL 187



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 35/42 (83%), Positives = 38/42 (90%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++LQ G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 22/50 (44%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DC+Q F+                 +++IREEYPDRI+ TFS+ PSP+VSD
Sbjct: 128 DCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSD 177


>SB_17881| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 458

 Score =  151 bits (365), Expect = 7e-37
 Identities = 75/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 256 QLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 315

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 316 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 375

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 376 IMNTFSVVPSPKVSDTVVEPYNATL 400



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 35/43 (81%), Positives = 38/43 (88%)
 Frame = +1

Query: 127 KMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           KMREI++ Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 213 KMREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 255



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 341 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 390


>SB_47198| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 446

 Score =  150 bits (364), Expect = 9e-37
 Identities = 74/145 (51%), Positives = 94/145 (64%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWA 434
           QLERINVYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWA
Sbjct: 43  QLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA 102

Query: 435 KGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTE 614
           KGHYTEG E+++S LDV+R+EAE     +   +T +              +   +  P  
Sbjct: 103 KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDR 162

Query: 615 LY*PFQSFQVPECRICVVEPYNTTL 689
           +   F     P+    VVEPYN TL
Sbjct: 163 IMNTFSVVPSPKVSDTVVEPYNATL 187



 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++ Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DCLQ F+                 +++IREEYPDRI+ TFSV PSP+VSD
Sbjct: 128 DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSD 177


>SB_39308| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 391

 Score =  125 bits (302), Expect = 3e-29
 Identities = 63/131 (48%), Positives = 80/131 (61%)
 Frame = +3

Query: 297 GKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESA 476
           GKYVPR VL+DL+P TMD+VRSGPFG +FRPDNFV+GQ+ A NNWAKGHYTEG E+++S 
Sbjct: 2   GKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSV 61

Query: 477 LDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECR 656
           LDV+R+EAE     +   +T +                  +  P  +   F     P+  
Sbjct: 62  LDVVRKEAESCDCIQGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVS 121

Query: 657 ICVVEPYNTTL 689
             VVEPYN TL
Sbjct: 122 DTVVEPYNATL 132



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRVSD 658
           DC+Q F+                 + +IREEYPDRI+ TFSV PSP+VSD
Sbjct: 73  DCIQGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVSD 122


>SB_48074| Best HMM Match : Tubulin (HMM E-Value=4.4e-27)
          Length = 144

 Score =  111 bits (266), Expect = 7e-25
 Identities = 45/71 (63%), Positives = 60/71 (84%)
 Frame = +3

Query: 291 SAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILE 470
           + G+YVPR++L+DL+P TMDAVR GP G +FRPDNFV  Q+ AANNWAKGHY+EG E+++
Sbjct: 11  TGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELID 70

Query: 471 SALDVIRREAE 503
           +  DV+R+EAE
Sbjct: 71  NIFDVLRKEAE 81



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +2

Query: 509 DCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFPSPRV 652
           DC+Q  +                 +++IREEYPDRI+  FSV PSP+V
Sbjct: 84  DCMQGVQLIQALGGGTGSGLGTLILSKIREEYPDRILSAFSVVPSPKV 131


>SB_18752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 39/50 (78%), Positives = 46/50 (92%)
 Frame = +3

Query: 255 QLERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVY 404
           QLERINVYYNEA+ GKYVPR +L+DL+P TMD+VRSGPFG +FRPDNFV+
Sbjct: 43  QLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVF 92



 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 34/42 (80%), Positives = 37/42 (88%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           MREI++ Q G CGNQIG KFWEVISDEHGIDP+G YHGDSDL
Sbjct: 1   MREIVHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDL 42


>SB_34400| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 380

 Score = 88.6 bits (210), Expect = 4e-18
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 46  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 105

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 106 HYTVGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 162

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 163 KSKLE----FAIYPAPQVSTAVVEPYNSIL 188



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 50


>SB_19437| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 885

 Score = 88.6 bits (210), Expect = 4e-18
 Identities = 55/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  V G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQVSTAVVEPYNSIL 189



 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 480 DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 539

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 540 HYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 596

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 597 KSKLE----FAIYPAPQVSTAVVEPYNSIL 622



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 435 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 484


>SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 452

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 51/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  +GK+VPR V  DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGSGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREAEG-------WIACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G E++++ LD +R+ A+G        I   F   T + +      R +     Y K
Sbjct: 107 HYTVGKEMIDTVLDRLRKLADGCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQISTAVVEPYNSVL 189



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G Q+G   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>SB_2674| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 1036

 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 54/150 (36%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 111 DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 170

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 171 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 227

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 228 KSKLE----FAIYPAPQISTAVVEPYNSIL 253



 Score = 87.8 bits (208), Expect = 7e-18
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261  ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
            +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 632  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 691

Query: 441  HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
            HYT G E+++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 692  HYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 748

Query: 600  SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
                E    F  +  P+    VVEPYN+ L
Sbjct: 749  KSKLE----FAIYPAPQVSTAVVEPYNSIL 774



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +1

Query: 121 INKMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           +   RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 510 VEYQRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 563



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           +RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 586 VRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 636



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G QIG   WE+   EHGI P G    D  +     +  T
Sbjct: 66  RECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 115



 Score = 36.7 bits (81), Expect = 0.018
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAV 356
           +  N +++E  AGK+VPR V +DL+P   + +
Sbjct: 559 DSFNTFFSETGAGKHVPRAVFVDLEPTVRECI 590


>SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 50/150 (33%), Positives = 81/150 (54%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P+ +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 465 DSFNTFFSETGAGKHVPRAVFVDLEPSVIDEIRTGTYRQLFHPEQLITGKEDAANNYARG 524

Query: 441 HYTEGVEILESALDVIRREA------EGWIAC-KFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G + +++ LD IR+ A      +G++    F   T + +      R +     Y K
Sbjct: 525 HYTVGKDHIDNVLDRIRKLADQCSGLQGFLVFHSFGGGTGSGFSALLLERLSVD---YGK 581

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 582 KSKLE----FAIYPAPQISTAVVEPYNSVL 607



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 52/150 (34%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V  DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 32  DSFNTFFSETGAGKHVPRAVFCDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 91

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G +++E  LD +R+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 92  HYTVGKQLIEIVLDRLRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 148

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 149 KSKLE----FAIYPAPQISTAVVEPYNSIL 174



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE +++ VG  G Q+G   WE+   EHGI P G    D  +     +  T
Sbjct: 420 RECVSIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 469


>SB_2003| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 451

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 53/150 (35%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 106

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G EI++  LD  R+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 107 HYTIGKEIIDLVLDRCRKLADQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVD---YGK 163

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 164 KSKLE----FAIYPAPQISTAVVEPYNSIL 189



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 19/51 (37%), Positives = 25/51 (49%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G Q+G   WE+   EHGI P G    D  +     +  T
Sbjct: 1   MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 51


>SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1231

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 53/150 (35%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261  ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
            +  N +++E  AGK+VPR V  DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 851  DSFNTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARG 910

Query: 441  HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
            HYT G E+++  LD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 911  HYTVGKEMIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVD---YGK 967

Query: 600  SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
                E    F  +  P+    VVEPYN+ L
Sbjct: 968  KSKLE----FAIYPAPQISTAVVEPYNSIL 993



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 36/82 (43%), Positives = 55/82 (67%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N ++ E  AGK+VPR V +DL+P  +D VR+G +  LF P+  + G+  AANN+A+G
Sbjct: 418 DAFNTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARG 477

Query: 441 HYTEGVEILESALDVIRREAEG 506
           HYT G E ++  LD +R+ A+G
Sbjct: 478 HYTVGKEQIDIVLDRLRKLADG 499



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/41 (43%), Positives = 22/41 (53%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDL 255
           RE I++ VG  G QIG   WE+   EHGI P G    D  +
Sbjct: 373 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 413



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = +1

Query: 133 REIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           RE I++ VG  G Q+G   WE+   EHGI P G    D  +     +  T
Sbjct: 806 RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNT 855


>SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 417

 Score = 85.0 bits (201), Expect = 5e-17
 Identities = 53/150 (35%), Positives = 79/150 (52%), Gaps = 7/150 (4%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N ++ E  AGK+VPR V +DL+P  +D +R+G +  LF P+  + G+  AANN+A+G
Sbjct: 12  DSFNTFFAETGAGKHVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLLSGKEDAANNYARG 71

Query: 441 HYTEGVEILESALDVIRREA------EGW-IACKFSDVTLARWRYRFRIRYATS*TGYAK 599
           HYT G E ++ ALD IR+ A      +G+ I   F   T + +      R +     Y K
Sbjct: 72  HYTVGKEHIDLALDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVD---YGK 128

Query: 600 SIPTELY*PFQSFQVPECRICVVEPYNTTL 689
               E    F  +  P+    VVEPYN+ L
Sbjct: 129 KSKLE----FAVYPAPQISTAVVEPYNSIL 154


>SB_19567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1383

 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 36/71 (50%), Positives = 53/71 (74%)
 Frame = +3

Query: 282  NEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVE 461
            +EA+AGKYVPR VL+DL+P  +D VR+G +  L+ P+  + G+  AANN+A+GHYT G E
Sbjct: 965  SEAAAGKYVPRAVLVDLEPTVIDEVRTGMYRYLYHPEQMISGKEDAANNYARGHYTIGKE 1024

Query: 462  ILESALDVIRR 494
            ++E  +D IR+
Sbjct: 1025 MVEVVMDKIRK 1035


>SB_48961| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 536

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 28/81 (34%), Positives = 47/81 (58%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVRSGPFGCLFRPDNFVYGQNCAANNWAKG 440
           +  N +++E  AGK+VPR V +DL+P  +             P+  + G+  AANN+A+G
Sbjct: 47  DSFNTFFSETGAGKHVPRAVFVDLEPTVV----------ALSPEQLITGKEDAANNYARG 96

Query: 441 HYTEGVEILESALDVIRREAE 503
           HYT G + ++  LD +R+ A+
Sbjct: 97  HYTIGKQQVDQVLDRLRKLAD 117



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSG 231
           MRE I++ VG  G QIG   WE+   EHGI P G
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDG 34


>SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 41/121 (33%), Positives = 60/121 (49%), Gaps = 7/121 (5%)
 Frame = +3

Query: 348 DAVRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREA------EGW 509
           D VR+G +  LF P+  + G+  AANN+A+GHYT G E+++  LD IR+ A      +G+
Sbjct: 13  DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGF 72

Query: 510 -IACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTT 686
            I   F   T + +      R +     Y K    E    F  +  P+    VVEPYN+ 
Sbjct: 73  LIFHSFGGGTGSGFSSLLMERLSVD---YGKKSKLE----FAIYPAPQISTAVVEPYNSI 125

Query: 687 L 689
           L
Sbjct: 126 L 126


>SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 377

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = +3

Query: 354 VRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREA------EGW-I 512
           VR+G +  LF P+  + G+  AANN+A+GHYT G E+++  LD IR+ A      +G+ I
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLI 62

Query: 513 ACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
              F   T + +      R +     Y K    E    F  +  P+    VVEPYN+ L
Sbjct: 63  FHSFGGGTGSGFSSLLMERLSVD---YGKKSKLE----FAIYPAPQISTAVVEPYNSIL 114


>SB_5512| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 365

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = +3

Query: 354 VRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRREA------EGW-I 512
           +R+G +  LF P+  + G+  AANN+A+GHYT G E ++ ALD IR+ A      +G+ I
Sbjct: 3   IRTGTYRQLFHPEQLLSGKEDAANNYARGHYTVGKEHIDLALDRIRKLADQCTGLQGFLI 62

Query: 513 ACKFSDVTLARWRYRFRIRYATS*TGYAKSIPTELY*PFQSFQVPECRICVVEPYNTTL 689
              F   T + +      R +     Y K    E    F  +  P+    VVEPYN+ L
Sbjct: 63  FHSFGGGTGSGFSSLLMERLSVD---YGKKSKLE----FAVYPAPQISTAVVEPYNSIL 114


>SB_35594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 22/47 (46%), Positives = 33/47 (70%)
 Frame = +3

Query: 354 VRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRR 494
           VR+G +  LF P+  + G+  AANN+A+GHYT G E+++  LD IR+
Sbjct: 3   VRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRK 49


>SB_25311| Best HMM Match : Tubulin (HMM E-Value=0)
          Length = 629

 Score = 51.2 bits (117), Expect = 8e-07
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +3

Query: 408 QNCAANNWAKGHYTEGVEILESALDVIRREAE 503
           QN AANNWAKG YTEG E+++S +D IR+ AE
Sbjct: 2   QNSAANNWAKGFYTEGAELMDSGMDCIRKLAE 33



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/66 (34%), Positives = 34/66 (51%)
 Frame = +2

Query: 461 DSGVCFRCHSKGS*GLDCLQVFRCHTRXXXXXXXXXXRYFVNRIREEYPDRIILTFSVFP 640
           DSG+   C  K +   D +Q F+                 +++IREEYPDR++ +F V P
Sbjct: 22  DSGM--DCIRKLAENCDTVQGFQIAHSLGGGTGSGLGSLLLSKIREEYPDRLVSSFCVLP 79

Query: 641 SPRVSD 658
           SP VS+
Sbjct: 80  SPLVSE 85


>SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24)
          Length = 149

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +3

Query: 354 VRSGPFGCLFRPDNFVYGQNCAANNWAKGHYTEGVEILESALDVIRR 494
           VR G +  LF PD  + G+  AANN+A+GHYT G E ++  L+ IR+
Sbjct: 3   VRMGTYRDLFHPDQLITGKEDAANNYARGHYTVGKEHIDLTLEKIRK 49


>SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/44 (47%), Positives = 25/44 (56%)
 Frame = +1

Query: 121 INKMREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSD 252
           I  MRE +++ VG  G QIG   WE+   EHGI P G  H  SD
Sbjct: 193 IQTMRECLSIHVGQAGVQIGNACWELYCLEHGIQPDG--HMPSD 234


>SB_28561| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 94

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +1

Query: 130 MREIINLQVGSCGNQIGGKFWEVISDEHGIDPSGCYHGDSDLNSKGSTCTT 282
           MRE I++ VG  G QIG   WE+   EHGI P G    D  ++    +  T
Sbjct: 1   MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIDGGDDSFNT 51



 Score = 34.7 bits (76), Expect = 0.072
 Identities = 11/33 (33%), Positives = 22/33 (66%)
 Frame = +3

Query: 261 ERINVYYNEASAGKYVPRTVLIDLKPATMDAVR 359
           +  N +++E   GK+VPR V +DL+P+ +  ++
Sbjct: 47  DSFNTFFSETGGGKHVPRAVFVDLEPSVVGRMK 79


>SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0)
          Length = 375

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/24 (66%), Positives = 22/24 (91%)
 Frame = +2

Query: 590 IREEYPDRIILTFSVFPSPRVSDL 661
           ++EEYPDRI+ + SVFPSPRVS++
Sbjct: 36  LQEEYPDRILSSVSVFPSPRVSEI 59


>SB_2586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 34.3 bits (75), Expect = 0.095
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = +1

Query: 187 FWEVISDEHGIDPSG 231
           FWEVI++EHGIDP G
Sbjct: 1   FWEVIAEEHGIDPDG 15


>SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44)
          Length = 474

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 11/24 (45%), Positives = 19/24 (79%)
 Frame = +1

Query: 139 IINLQVGSCGNQIGGKFWEVISDE 210
           I+ LQ+G CGNQIG + +++I ++
Sbjct: 3   IVTLQLGQCGNQIGRELFDLIVED 26



 Score = 30.7 bits (66), Expect = 1.2
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = +3

Query: 417 AANNWAKGHYTEGVEILESALDVIRREAE 503
           + NNWA G    G + ++  LD+++RE E
Sbjct: 105 SGNNWAHGFSEHGPKSIDKVLDLVQREVE 133


>SB_33414| Best HMM Match : TSP_1 (HMM E-Value=0.00041)
          Length = 428

 Score = 31.1 bits (67), Expect = 0.89
 Identities = 17/65 (26%), Positives = 33/65 (50%)
 Frame = +3

Query: 426 NWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS*TGYAKSI 605
           N +   Y    E  ESAL+ + +E EG++  +  D++     + +R RY  + T  ++ +
Sbjct: 299 NKSSEDYKAEKERFESALEPVMKETEGFLDAEVIDMSKGSIMFTYRARYRRTSTITSERM 358

Query: 606 PTELY 620
            + LY
Sbjct: 359 RSTLY 363


>SB_18800| Best HMM Match : Cytomega_UL20A (HMM E-Value=7.7)
          Length = 140

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = +3

Query: 420 ANNWAKGHYTEGVEILESALDVIRREAEGWIACKFSDVTLARWRYRFRIRYATS 581
           A+   + H T+  E  ++ +  IR     WI  + SDV L  W+   R+R +T+
Sbjct: 79  ASTAPRTHETDKSERTKTIIKTIRVSDVNWIDWQVSDVNLIDWQVSERVRDSTA 132


>SB_6478| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 621

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/51 (27%), Positives = 22/51 (43%)
 Frame = +2

Query: 278 LQRGIGWEICSSHGSYRLEAGHDGRGEVGTLRMPIQTGQFRLRTKLCGQQL 430
           L  G G  +     SY L+ G D    +  L+ P+  G F    +L  +Q+
Sbjct: 350 LNTGFGNALVGFFKSYSLDPGGDSENSLNRLQNPVDPGNFLFPEELSNEQI 400


>SB_50370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1059

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 9/25 (36%), Positives = 18/25 (72%)
 Frame = +2

Query: 581 VNRIREEYPDRIILTFSVFPSPRVS 655
           + +++E+YPD I+ +F +FP  + S
Sbjct: 484 LKKLQEQYPDHILSSFELFPCEKAS 508


>SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0)
          Length = 1227

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -1

Query: 604  ILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLRMTSKADSRI 461
            I F + V     L+RNR +   +  +   Q IQPSA L + SK   R+
Sbjct: 975  IFFTFSVKNHRILLRNRPKAGTASNAFCKQGIQPSAILDVDSKISFRV 1022


>SB_43063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 17/63 (26%), Positives = 29/63 (46%)
 Frame = -1

Query: 619 YNSVGILFAYPVHEVAYLIRNRYRHLASVTSENLQAIQPSASLRMTSKADSRISTPSV*C 440
           YN +GI FA  V E   ++   +   A++   ++  +  S  L+M  K +   S   V  
Sbjct: 98  YNMIGIPFAAGVFEPLGVVMKPWMASAAMALSSVSVVTSSLMLKMYKKPEPDESQMGVRL 157

Query: 439 PFA 431
           PF+
Sbjct: 158 PFS 160


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,579,411
Number of Sequences: 59808
Number of extensions: 450216
Number of successful extensions: 1340
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1334
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1805522550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -