SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30120.Seq
         (576 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5)                    46   3e-05
SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51)                   46   3e-05
SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.1  
SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42)          29   3.6  
SB_16259| Best HMM Match : AAA (HMM E-Value=0.43)                      28   6.3  
SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)           28   6.3  
SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.3  
SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.3  
SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.3  

>SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5)
          Length = 85

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 25  MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62


>SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51)
          Length = 137

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 25  MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62


>SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 566

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402
           +Q+QAD+LGI V RP M E+TALGAA+ AG A  + VW
Sbjct: 436 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 473


>SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -2

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +++ + L G  + RP   + + LGAA +AG A  VW
Sbjct: 21  MELTSSLTGQSMDRPSQTDMSVLGAAFLAGMATGVW 56


>SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 964

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%)
 Frame = +3

Query: 363 QECIGRW--AGYCRGPHTHCATC 425
           QEC+GRW  A + RG H  C  C
Sbjct: 26  QECLGRWNVAQFFRGRHPTCPHC 48


>SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42)
          Length = 355

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/36 (33%), Positives = 22/36 (61%)
 Frame = -2

Query: 575 AAXLRAPEATPRRRRDGAELSSVQMQADLLGIPVIR 468
           A+ +R PEATP  + DG ++  + +Q+    + VI+
Sbjct: 164 ASLMRMPEATPGIQIDGVDICGLNLQSTRQAVSVIQ 199


>SB_16259| Best HMM Match : AAA (HMM E-Value=0.43)
          Length = 538

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 18/50 (36%), Positives = 23/50 (46%)
 Frame = -1

Query: 543 SPTEGWRRTQFCADAG*FTGYTSHSSPHDGKYSPGGGHCRRSRNACVAHD 394
           SP  G+R T F    G  T +   +S H  + S  G      RNACV+ D
Sbjct: 484 SPYLGFRSTSF-TPLG--TAFAYMASVHTRRTSSRGNRLNMRRNACVSQD 530


>SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32)
          Length = 456

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = -3

Query: 502 CRLIYWVYQSFVPS*WKVQPWGRPLSQVAQCVCGPRQYPAHRPIHSCRLLPMKNEKCGEF 323
           CR +   +Q  VP+  + Q WG  + +  +C    +Q    R  H  +LL  +  +CGE+
Sbjct: 290 CRQVAVYHQRGVPT-LEEQEWGVGVVEEYKCPTCSQQIRFPRYNHPAKLLETRCGRCGEW 348


>SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3293

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +1

Query: 385  LGIVVGHTRIARPATMAAPRAVLSIMRGRMTGI 483
            +G+ + HTR+A  +   A   VLSI R R+ G+
Sbjct: 1618 VGLSIHHTRLADVSIHHARLGVLSIHRSRLVGL 1650


>SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 825

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = +3

Query: 351 GKSRQECIGRWAGYCRGPHTHCAT 422
           G + Q C G  AGYC  P  HC T
Sbjct: 751 GSAAQHC-GTNAGYCGIPSNHCGT 773


>SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1300

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = +3

Query: 387 GYCRGPHTHCATCDNGRPQGCTFHHEG 467
           G C+     C TC    P+ CTF  +G
Sbjct: 470 GICKSCDPGCTTCSTSDPKKCTFCAKG 496


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,667,946
Number of Sequences: 59808
Number of extensions: 401481
Number of successful extensions: 895
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 894
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1373676929
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -