SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30119.Seq
         (448 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   1e-08
SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48)                  37   0.007
SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.1  
SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.3  
SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06)                    27   9.3  

>SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 849

 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 24/38 (63%), Positives = 30/38 (78%)
 Frame = +3

Query: 42  MAKPKGERKGKSAINEVVTREYTVNLHKRLHGVGFKKR 155
           M K   ++KG+SAINEVVTREYT+NLHKR+HG+    R
Sbjct: 769 MVKKTDKKKGRSAINEVVTREYTINLHKRIHGMNVPYR 806



 Score = 47.2 bits (107), Expect = 6e-06
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTYVPVASIKGLQTENVDA 403
           N+DEDS HKL+TLVT V V++ KGLQT+ V++
Sbjct: 816 NEDEDSPHKLYTLVTSVAVSTFKGLQTQKVES 847


>SB_42441| Best HMM Match : DUF1484 (HMM E-Value=0.48)
          Length = 776

 Score = 37.1 bits (82), Expect = 0.007
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +2

Query: 308 NDDEDSAHKLFTLVTYVPVASIKGLQTE 391
           N+DEDS HKL+TLVT V V++ K L  E
Sbjct: 16  NEDEDSPHKLYTLVTSVAVSTFKVLADE 43


>SB_37851| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 27.1 bits (57), Expect = 7.1
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +3

Query: 66  KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRK 185
           K K  INEV+T  Y     + L      KR  R IKE+ +
Sbjct: 213 KNKPEINEVITPRYPPGEGEVLDDASIIKRYKRQIKELEE 252


>SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 327

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 3/73 (4%)
 Frame = +3

Query: 30  LKITMAKPKGERKGKSAINEVVTREYTVNLHKRLHGV-GFKKRAPRAIKEIRKFAE--KQ 200
           + + + K K  R+     NE + REY   LHK L  +  F    PR     R   +  KQ
Sbjct: 91  IALVIEKDKSLRRKIEEENEQLKREYLQQLHKTLEALRTFDFNNPRDAIFKRNLVKMHKQ 150

Query: 201 MGTPDIRVDTRLN 239
           +G   +RV   +N
Sbjct: 151 VGNYCLRVYGEMN 163


>SB_14516| Best HMM Match : PH (HMM E-Value=6.8e-06)
          Length = 438

 Score = 26.6 bits (56), Expect = 9.3
 Identities = 20/69 (28%), Positives = 29/69 (42%)
 Frame = -1

Query: 247 RNLFKRVSTRMSGVPICFSANFRISLIALGARFLNPTP*SRLCKLTVYSRVTTSFMADLP 68
           RNL KRV  R    P C   + R +     +  L      R CK +V S  +T+  +   
Sbjct: 214 RNLAKRVHERFGDAPGCEFRHRRRNSGVGTSEILTDCSGERSCKRSVTSNRSTNSSSKER 273

Query: 67  FLSPLGLAI 41
           ++ PL   I
Sbjct: 274 WMGPLASCI 282


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,799,644
Number of Sequences: 59808
Number of extensions: 246754
Number of successful extensions: 481
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 462
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 480
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 883875528
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -