SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30117.Seq
         (608 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   7e-05
SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38)                   33   0.14 
SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.9  
SB_8547| Best HMM Match : Amelogenin (HMM E-Value=8.1)                 29   3.9  

>SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 214

 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = +3

Query: 363 KGFEAAGVTGPGGEPVKGSPYAADKRRGYHR 455
           +G EA+ VTGP GEPV+GS YA D+RR  +R
Sbjct: 13  QGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 43


>SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38)
          Length = 80

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = +1

Query: 175 IAEKVSGTVKWFNVKSGYGFI 237
           ++ + +GTVKWFN + GYGFI
Sbjct: 12  MSNRQNGTVKWFNDEKGYGFI 32



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +3

Query: 255 EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGV 386
           +D+FVH  AI  +      +S+ +G+AV F    G+KG +A  V
Sbjct: 38  DDLFVHFKAIQSDG----FKSLKEGQAVTFVATRGQKGMQAEEV 77


>SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 559

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%)
 Frame = +3

Query: 285 ARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAGVTGPGG-EPVKGSPYAADKRRG 446
           AR    +AVR    GE    +V  G  G    G  G GG E V+G+PY  ++  G
Sbjct: 395 AREYLARAVREGLRGEEGSPSVFLGGGGRGGGGGDGGGGGEGVQGTPYTPEEEEG 449


>SB_26212| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = +2

Query: 404 ASKRLTLCCRQAPWLPP 454
           AS   T+C RQAPWL P
Sbjct: 19  ASPTWTICLRQAPWLSP 35


>SB_8547| Best HMM Match : Amelogenin (HMM E-Value=8.1)
          Length = 201

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 12/39 (30%), Positives = 16/39 (41%)
 Frame = -1

Query: 320 DRAHSLTWVVTGDGSLMHKHIFLVSFLLMKPYPLLTLNH 204
           +  H   W  T D    H  +F    LL  PY ++ L H
Sbjct: 144 EEGHVTGWSATSDARFEHSALFPARGLLQFPYSVMDLRH 182


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,596,163
Number of Sequences: 59808
Number of extensions: 249780
Number of successful extensions: 770
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 769
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1487884875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -