SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45627| Best HMM Match : AAA (HMM E-Value=0)                        120   1e-27
SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_53844| Best HMM Match : SRCR (HMM E-Value=0)                        28   8.2  
SB_35950| Best HMM Match : SRCR (HMM E-Value=0)                        28   8.2  
SB_9672| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.2  

>SB_45627| Best HMM Match : AAA (HMM E-Value=0)
          Length = 628

 Score =  120 bits (289), Expect = 1e-27
 Identities = 51/57 (89%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKV+ETDPSP+CIVAPDTVIHC+GEP+KREEEEE+LN VGYDDIGGCRKQL
Sbjct: 111 GMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEVGYDDIGGCRKQL 167



 Score =  106 bits (254), Expect = 2e-23
 Identities = 48/61 (78%), Positives = 58/61 (95%)
 Frame = +3

Query: 72  DDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKRRKETVC 251
           D+L+TAIL+ K RPNRL+VEEAV+DDNSVV +SQAKME+LQLFRGDTVL+KGK+RK+TVC
Sbjct: 5   DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTVC 64

Query: 252 I 254
           I
Sbjct: 65  I 65


>SB_56456| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1266

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = +1

Query: 88  RSSVARTDPTVSLSKKQSAMTTQSWHFHRPKWSNFNSSVVTQSCSRANAARKP 246
           RSSV R   T ++  K S +T ++W     +WSN++    + S SR ++ R P
Sbjct: 364 RSSV-REQATATVMSKGSYITIRNW----TRWSNYSGGGYSISNSRPSSRRNP 411


>SB_53844| Best HMM Match : SRCR (HMM E-Value=0)
          Length = 415

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -1

Query: 570 HDAKW*WICFDHFELDGAHAPRTMKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 394
           H   W  IC+DH++L  AH      V+ R +G  A +K   K T + LP V     S +G
Sbjct: 255 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 307

Query: 393 S 391
           +
Sbjct: 308 N 308


>SB_35950| Best HMM Match : SRCR (HMM E-Value=0)
          Length = 501

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -1

Query: 570 HDAKW*WICFDHFELDGAHAPRTMKVSSRWIGR*ASMKYGFKYTSNRLP-VRPSTESSIG 394
           H   W  IC+DH++L  AH      V+ R +G  A +K   K T + LP V     S +G
Sbjct: 318 HAGAWGLICYDHWDLHDAH------VACRQVGL-AGVKAVTKETVDGLPRVHLGNVSCVG 370

Query: 393 S 391
           +
Sbjct: 371 N 371


>SB_9672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = +1

Query: 526 EFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDD-IGGCRKQ 678
           +++  +  P PFCI+    VI   G P+ R + + + N   Y   IG   KQ
Sbjct: 117 QYREPQRPPPPFCILNVKKVIKHSGSPVYR-DPDSSQNRYQYSTLIGNSSKQ 167


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,199,825
Number of Sequences: 59808
Number of extensions: 474672
Number of successful extensions: 1188
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1188
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1793485733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -